KEGG   Rhodopseudomonas palustris CGA009: RPA4314Help
Entry
RPA4314           CDS       T00153                                 

Gene name
gstA2
Definition
(GenBank) possible glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RPA4314 (gstA2)
Enzymes [BR:rpa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RPA4314 (gstA2)
Transporters [BR:rpa02000]
 Other Transporters
  Pores ion channels [TC:1]
   RPA4314 (gstA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: CAE29755
CyanoBase: RPA4314
CYORF: RPA4314
UniProt: Q6N1U0
LinkDB All DBs
Position
complement(4864211..4864804)
Genome map
AA seq 197 aa AA seqDB search
MKIYGDFNSGNCLKVKWTCDRLGLPYEWIAIDTMKGETRTPAFLKLNPAGQVPVVAFDDG
RSLAQSNAVIRYLARGSDLIPADPWLAAKMDEWLFWEQYSHEPYIAVCRFQMVYLGKPAS
ELDPDKVRRGHAALARMEQHLANSEFLAGERLSLADVALLAYTRMAEQGGFELHDYPAIR
GWISRAEAGLGLPAFSS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaagatctacggcgacttcaactccggcaattgcctgaaggtgaagtggacctgcgac
cggctgggtctgccttatgagtggatcgcaatcgacacgatgaagggcgagacccggacg
ccggcgttcctgaagctgaatccggccggacaggtgccggtggtcgcgttcgacgatggc
cgctcgctggcgcaatccaacgccgtgatccgttatctcgcccgcggcagcgacctgatc
cccgccgatccgtggctcgcggccaagatggacgagtggctgttctgggagcaatatagc
cacgagccgtatatcgcggtgtgccgcttccagatggtctatctcggcaagccggccagc
gaactggatccggacaaggttcgccgcggccacgccgcgctggcccggatggagcagcat
ctggcgaattccgaatttcttgccggcgagaggctgtcgctcgccgatgtggcgctgctg
gcctacacccggatggcggagcagggtggtttcgagctgcacgactatccggccattcga
ggttggatcagccgcgccgaagctgggctcggcttgcctgcttttagttcgtga

DBGET integrated database retrieval system