KEGG   Rhodopseudomonas palustris HaA2: RPB_1759Help
Entry
RPB_1759          CDS       T00321                                 

Definition
(GenBank) nitrate transport permease
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    RPB_1759
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    RPB_1759
Transporters [BR:rpb02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    RPB_1759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2012085..2012984)
Genome map
AA seq 299 aa AA seqDB search
MSMTAIKSETETITVLAPPPSAVVAMRPKLQPRADKYIKAARETAARVIPPLIVFTLLMV
FWELVCRQAGSALPPPSKVYSDTKELIFDPFFDRGGLDKGLFWHLSASLQRVALGYSLAA
IVGIALGVLVGQSVWAMRGLDPIFQVLRTIPPLAWLPLALAAFRDGQPSAIFVIFITSIW
PIIINTAVGIRNIPQDYRNVAAVVQLNPLEFFTKVMLPSAAPYIFTGLRIGIGLSWLAII
AAEMLIGGVGIGFFIWDAWNSSHISEIILALFYVGIIGFVLDRMIAGLGRIVTHGTSAG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgaccgccatcaaatccgagaccgagaccatcaccgtgctcgcgccgccacct
tccgcggtggtggcgatgcgaccgaagctgcagccgcgcgcggacaaatacatcaaggcg
gcgcgcgagaccgcggcccgggtgatcccgccgctgatcgtgttcacgctgctgatggtg
ttctgggagctggtctgccgccaggcgggttcggcgttgccgccgccgtccaaggtctac
agcgacaccaaggagttgatcttcgatccgttcttcgatcgcggcggcctcgacaagggg
ctgttctggcatctgagcgccagcctgcagcgtgtcgcgctgggctactcgctggcggcg
atcgtcggcatcgcgctcggcgtgctggtcggccagtcggtgtgggcgatgcgcggactc
gatccgatcttccaggtgttgcgcacgattccgccgctggcctggctgccgctggcgctc
gccgccttccgcgacggccagccctcggcgatcttcgtgatcttcatcacctcgatctgg
ccgatcatcatcaacaccgctgtcggcatccgcaacattccgcaggactatcgcaacgtc
gccgccgtggtgcagctcaatccgttggagtttttcaccaaggtgatgctgccctcggcg
gcgccctacatcttcaccggcctgcgtatcggcatcggcctgtcgtggctggcgatcatt
gccgccgagatgctgatcggcggcgtcggcatcggcttcttcatctgggacgcctggaat
tcttcgcatatcagcgagatcattctggcgctgttctatgtcggcatcatcggcttcgtg
ctcgaccgcatgatcgcggggctcggccggatcgtcacccacggcacctctgcaggttaa

DBGET integrated database retrieval system