KEGG   Rhodopseudomonas palustris HaA2: RPB_3592Help
Entry
RPB_3592          CDS       T00321                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPB_3592
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RPB_3592
   00680 Methane metabolism
    RPB_3592
Enzymes [BR:rpb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     RPB_3592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(4117754..4120555)
Genome map
AA seq 933 aa AA seqDB search
MSSMILPTEPEALPNRADDSAALEAETRLRNDIRLLGRILGDTVRDQEGAAVFDLVEGIR
QTSIRFHRDDDTTARRELEAILDGMSASDTVKIVRAFSYFSHLANIAEDQNNIRQMRVGS
TAGSAPRAGMLAKTLAHARADGIGAAELRDFFKTALVSPVLTAHPTEVRRKSTMDREMQI
AALLDERERVQLTPEEWEQNEEQLRRAVVTLWKTNLLRRTKLTVLDEVTNGLSFYDYTFL
REVPRLHCALEDQLGGGEGAEADAELASFLRMGSWIGGDRDGNPFVTAEVLHGTLQLQSA
RVLRFYLDELHELGSELSLASHLVAISDEVRALAERSPDHSPHRRHEPYRLAVSGIYARL
AATAAKLRIDSIRAPVGEAEAYASVHDFKADLDAIHRSLVAHNAGVIARGRLRQLRRAAD
CFGFHLASLDMRQNSAVHERTIAELMNAAHPASAYLEIGEDARIALLTAELRSARPLTSI
FVKYSDETVGELAVLHEAAQAHATYGAAAIPQCIISMTKGVSDLLEVAVLLKEVGLIDPS
GRSAINIVPLFETIEDLQASSAIMDRLLGIPEYRRLVDSRGGVQEVMLGYSDSNKDGGFV
TSGWELYKAEIGLIEIFEHHGIRLRLFHGRGGSVGRGGGPSYDAIVAQPGGAVNGQIRIT
EQGEIITSKYSNREVGRNNLEILTAATLEASLLQPKRVAPQRDYLDAMEQLSAMAFKAYR
GLVYETDGFVDYFWASTVITEISTLNIGSRPASRKKTRAIEDLRAIPWVFSWAQCRLMLP
GWYGFGSAVEAWIAAHPDKGVPFLRSMYQEWPFFRTLLSNMDMVLSKSSLGIASRYAELV
PDETLRREIFGRIRAEWHASVDGLLAIMGHDKLLQGNPLLDRSIRHRFPYLDPLNHVQVQ
LLREHRTHDPDEQILRGIQLTINGISAGLRNSG
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccatgatcctgccgaccgagcccgaggcgctgccgaaccgcgccgacgacagt
gccgcgctggaggccgagacgcggctgcgcaacgacatccggctgctcggccggattctc
ggcgacaccgtgcgcgaccaggaaggcgccgcggtgttcgatctggtcgagggcatccgc
cagacctcgatccggtttcaccgcgacgacgacaccaccgcgcggcgcgagctcgaagcc
atcttggacggcatgtcggcctccgacaccgtgaagatcgttcgtgccttcagctatttc
tcgcacctcgccaacatcgccgaagaccagaacaacatccgccagatgcgggtcggctcg
accgcgggctcggcgccgcgtgccggcatgctggccaagacgctcgcgcatgcgcgcgcg
gacgggatcggcgcagccgagctgcgcgatttcttcaagaccgctctggtgagcccggtg
ctgaccgcgcatccgaccgaggtgcggcgcaagagcacgatggaccgcgagatgcagatc
gcggccttgctcgacgagcgcgagcgcgtccagctcacgcccgaggaatgggagcagaac
gaggagcagctccgccgcgcggtggtgacgttgtggaagaccaatctgttgcgccggacc
aagctgacggtgctcgacgaagtcaccaacggcctgtcgttctacgactacaccttcctg
cgcgaggtgccgcggctgcattgcgcgctggaggatcagctcggcggcggcgagggcgcc
gaggccgatgcggaactcgcgagcttcctgcggatgggaagctggatcggcggcgaccgc
gatggcaatccgttcgtcaccgccgaggtgctgcacggcacgttgcaattgcagagcgcc
cgcgtgctgcggttctatctcgacgaactgcacgagctcggctcggaattgtcgctggcg
tcgcatctggtggcgatcagcgacgaggtccgcgcgctggccgagcgctcaccggatcat
tcgccgcatcgccgccacgagccgtatcggctggcggtgtcgggaatttatgcgcggctg
gccgcgaccgcggcgaagctgaggatcgacagcatccgcgccccggtcggcgaagccgag
gcttacgcgagcgtgcacgacttcaaggccgatctcgacgcgatccatcgttcgctggtc
gcccacaatgccggcgtgatcgcgcggggccggctgcggcagctgcgccgcgccgccgat
tgcttcggcttccacctcgccagcctcgacatgcggcagaattccgcggtgcacgagcgc
accatcgccgaactgatgaacgcggcgcatccggccagcgcctatctggagatcggcgaa
gacgcacggatcgcgctactcactgccgagctgcgcagcgcccggccgctgacctcgatc
ttcgtcaaatacagcgacgagaccgtcggcgaactcgcggtgctgcacgaggcggcgcag
gcgcacgccacttacggcgcggcggcgatcccgcaatgcatcatctcgatgaccaagggc
gtctccgacctgctcgaagtcgcggtgctgctcaaggaggtcggactgatcgatccgtcg
gggcgcagcgcgatcaacatcgtgccgctgttcgagaccatcgaggatctgcaggcctcc
tcggcgatcatggaccggctgctcggcatcccggaatatcgccggctggtcgacagccgc
ggcggcgtgcaggaagtgatgctcggctattcagacagcaacaaggacggcggcttcgtc
acctccggctgggaactgtacaaggccgagatcgggttgatcgagatcttcgaacatcac
ggcatccggctgcggctgttccacggccgcggcggctcggtcggccgcggcggcgggccg
agctacgacgccatcgtggcgcagcccggcggcgcggtgaacggccagatccgcatcacc
gagcagggcgagatcatcaccagcaaatattccaaccgcgaggtcggccgcaacaatctg
gagatcctcaccgcggcgacgctggaggcgagcctgctgcagcccaagcgcgtcgcgccg
cagcgcgactatctcgacgcgatggagcagctctcggcgatggccttcaaggcctatcgc
ggcctggtctacgagaccgacggcttcgtcgattacttctgggcctcgacggtgatcacg
gagatctcgacgctgaacatcggcagccggccggcgtcgcgcaagaagacccgcgcgatc
gaggatctgcgcgcgatcccctgggtgttctcatgggcgcaatgccggctgatgctgccc
ggctggtacggcttcggcagcgcggtcgaggcctggatcgccgcgcatcccgacaagggc
gtcccgttcctgcgatcgatgtatcaggaatggccgttcttccgcacgctgctgtcgaac
atggacatggtgctttcgaagagctcgctcggcatcgcctcgcgctacgccgaactggtt
cccgacgagacgctgcggcgggagatcttcggccgcatccgcgccgaatggcacgcttcg
gtcgacggcctgctggcgatcatgggccacgacaagctgctgcagggcaacccgctactc
gaccgctcgatccgccaccgcttcccgtatctcgacccgctcaaccacgtccaggtgcag
ttactccgcgagcaccgcacgcatgatcccgacgagcagattctgcgcggcattcagctg
acgatcaacgggatctcggcggggctgcggaacagcggctga

DBGET integrated database retrieval system