KEGG   Rhodopseudomonas palustris BisB5: RPD_1876Help
Entry
RPD_1876          CDS       T00345                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00620  Pyruvate metabolism
rpd00680  Methane metabolism
rpd00710  Carbon fixation in photosynthetic organisms
rpd01100  Metabolic pathways
rpd01120  Microbial metabolism in diverse environments
rpd01200  Carbon metabolism
Module
rpd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPD_1876
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RPD_1876
   00680 Methane metabolism
    RPD_1876
Enzymes [BR:rpd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     RPD_1876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABE39111
JGI: RPD1876
UniProt: Q139X8
LinkDB All DBs
Position
2102526..2105327
Genome map
AA seq 933 aa AA seqDB search
MSSTILPTDPDVLPNRADDSAFIEEDTRLRNDIRLLGRILGDTVRDQEGSAVFDLVERIR
QTSIRFHRDEDKPARRELEAILDDMSASDTVKIVRAFSYFSHLANIAEDQNNIRQMRAGS
TAGSAPRAGMLAKTLAHAREEGIGARELREFFKTALVSPVLTAHPTEVRRKSTMDREMEV
AALLDQRERLQLTADEWAQNEEQLRRAVVTLWKTNLLRRTKLTVLDEVANGLSFYDYTFL
REVPRLHSALEDQLGGGEGGEAEEELASFLRMGSWIGGDRDGNPFVTAEVLQGTLRLQSA
RVLRFYLDELHELGSELSLASHLAPITEDVRLLAERSPDHSPHRRHEPYRLAVSGIYARL
AATAAKLKIDSVRAPVGEAEIYANVQEFKADLDAIHYSLTKYNAGVIARGRLRQLRRAAD
CFGFHLASLDMRQNSAVHERTMGELMDAARPTSSYLALDEDERIALLTGELRSARPLTSI
FIKYSDETVGELAVLHEAARAHSIYGEAAIPQCIISMTKGVSDLLEVAVLLKEVGLIDPS
GRCAINIVPLFETIEDLQACAAIMDRLLAIPEYRRLVDSRGGVQEVMLGYSDSNKDGGFV
TSGWELYKAEIGLLDVFEHHGVRLRLFHGRGGSVGRGGGPSYDAIVAQPGGAVNGQIRIT
EQGEIITSKYSNREVGRNNLEILTAATLEASLLQPRRSAPHHDYLEAMEQLSALAFKAYR
GLVYETDGFVDYFWSSTVINEISTLNIGSRPASRKKTRAIEDLRAIPWVFSWAQCRLMLP
GWYGFGSAVEAWVAEHPDKGTAFLQSMYQEWPFFRMLLSNMDMVLSKSSIAIASRYADLV
PDEELRHKIFGRIRIEWHASVDSLLAIMGHERLLQGNPLLERSIRHRFPYLDPLNHVQVQ
LLREHRTHDPDEQVLRGIQLTINGISAGLRNSG
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccacgatcctgccgaccgaccccgacgttctgccgaaccgggcggacgacagc
gcttttatcgaagaggacaccaggcttcgcaatgacatacggctgttgggccggatactt
ggcgataccgtgcgcgaccaggagggctctgcggtgttcgacttggtcgaacgcatccgg
cagacctccatccggtttcaccgggacgaggacaagccggcgcgacgcgaactcgaagcg
atcctcgacgacatgtcggcctcggacacggtgaagatcgtccgggcattcagctacttt
tcgcatctcgccaacatcgccgaagatcaaaacaacatccgccagatgcgcgccggctcg
acggcaggctcggcgcctcgcgcggggatgctggccaagaccctggcgcatgcgcgcgag
gaagggatcggcgcgcgcgagctgcgcgaattcttcaagaccgcgctggtcagcccggtg
ctgacggcgcatccgaccgaggtgcgccgcaagagcacgatggaccgcgagatggaggtc
gcagcgctgctcgatcaacgcgagcgcctccagctcaccgctgacgagtgggcgcagaac
gaggagcagcttcgtcgcgcggtggtgacgctgtggaaaaccaacctgctgcgccggacc
aagctgacggtgctcgacgaagtcgccaacggcctgtcgttctatgactacaccttcttg
cgcgaagtgccgcggctgcacagcgcgttggaggatcagctcggcggcggcgagggcggc
gaagcggaagaggagctggcgagtttcctgcggatgggaagctggatcggcggcgatcgc
gacggcaatccgttcgtcacagccgaggtgctgcaggggacgctgcggttgcagagcgcg
cgcgtgctgcggttctatctcgacgagctgcacgagctcggctcggagctgtcgctggcg
tcgcatctcgccccgatcaccgaagacgtccgtttgctagctgaacgttcgcccgatcat
tcgccgcatcgccgccacgagccctatcggctggcggtgtcaggcatctatgcgaggctc
gccgccaccgcggcgaagctgaagatcgacagcgtccgcgccccggtcggcgaggccgag
atttacgccaacgtgcaggagttcaaagccgacctcgatgcgatccattactcgctgacc
aaatataatgccggcgtgatcgcgcgcggcagactccggcagctgcgccgcgccgccgac
tgtttcggctttcatctcgccagcctcgacatgcggcaaaactcagcggtgcacgagcgc
actatgggcgagctgatggacgcggcgcggccgaccagctcctatctggcgctcgatgag
gacgaacgcatcgcgctgctcaccggcgaactgcgcagcgcccggccgctgacctcgatt
ttcatcaagtatagcgacgagaccgtcggcgaactcgcggtgctgcacgaggcggcgcgg
gcgcactccatttatggcgaggcggcgattccccagtgcatcatctcgatgaccaagggc
gtgtccgatctgctcgaggtcgcggtgctgctcaaggaagtcgggctgatcgatccatcg
ggccgttgcgcgatcaacatcgtgccgctgttcgagaccatcgaagacctgcaggcctgc
gccgcgatcatggaccggctgctggcgatcccggaatatcgccgcctggtcgacagccgc
ggcggcgtgcaggaggtgatgctcggttactccgacagcaacaaggacggcggcttcgtc
acatccggttgggagctctacaaggccgagatcggcttgctcgacgtgttcgagcaccat
ggcgttcggctgcggctgttccacggccgcggcggttcggtcggccgcggcggcggcccg
agctacgacgcgatcgtagcgcagccgggcggcgcggtgaacggccagattcgcatcacc
gagcagggcgagatcatcaccagtaaatattccaaccgcgaggtcggtcgcaacaatctg
gaaatcctcaccgcggcgacgctggaggcgagcctgctgcagccgcgccgcagcgcgcca
caccacgactatctggaagcgatggagcagctctcggcgctggccttcaaggcgtatcgc
ggactggtctacgagaccgacggcttcgtcgactacttctggtcgtcgactgtgatcaac
gagatctcgacgctgaacatcggcagccgcccggcatcgcgcaagaagacccgcgcgatc
gaggatctgcgcgccatcccctgggtgttctcttgggcgcaatgccggctgatgctgccg
ggctggtacggcttcggcagcgcggtcgaggcctgggtcgccgagcatcccgacaagggc
actgcgttcctgcagtcgatgtatcaggagtggccgttcttccgcatgctgctctccaac
atggacatggtgctgtcgaagagttcgatcgcgatcgcctcgcgctacgccgatctggtg
ccggatgaggagttgcggcacaagatcttcggccgcatccgcatcgaatggcatgcctcg
gtcgatagcctgctcgcgatcatgggccacgaacggctgctgcagggcaacccgctgctg
gagcgctcgatccgccaccgcttcccgtatctcgacccgcttaaccacgtccaggtgcag
ctcctgcgcgagcaccgcacccacgatcccgacgagcaggtgctgcgcgggattcagctg
accatcaacggaatttcggcggggctgcggaatagcgggtga

DBGET integrated database retrieval system