KEGG   Rhodopseudomonas palustris BisA53: RPE_3724Help
Entry
RPE_3724          CDS       T00400                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    RPE_3724
Enzymes [BR:rpe01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RPE_3724
DNA repair and recombination proteins [BR:rpe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     RPE_3724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ABJ07653
JGI: RPE3724
UniProt: Q07K81
LinkDB All DBs
Position
complement(4163405..4166128)
Genome map
AA seq 907 aa AA seqDB search
MVRSSLNLYRKKRDFEQTAEPSGEAPVAPSKRRRFVIQKHDATRLHYDLRLEFDGVFKSW
AVTRGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVMLWDRGFWECDDPERGF
KNGDLKFTLEGDKLHGGFVLVRMKHDRSGGKRTNWLLIKHRDEFAREGDADGILDEDRSV
ASGRAMAEIAAGKGRAPKPFMLRKSARAKADAVWNSNRGEAAEARNASASAARKSAPLKE
TPSKSTARRPKRAASSASAMARSGKPAPMPDFVAPQLCTSLERPPGGAGWVHEIKFDGYR
VQLRVENGRAVLNTRKGLDWTAKFKAIAQQAASLPDAIIDSEIVALDHKGAPDFAALQAA
LSDGATDDLICFAFDLLYAEGEDLRRLPLSERKARLKQMLDAARGRRKDGLIRYVEHFET
GGDAVLQSACQMSLEGIVSKKLAAPYRSGRTDAWTKSKCRAGHEVVIGGWKSNAGKFRSL
LVGVHRDDHLAYVGVVGTGFGRDMVRRIMPALEAAAADQNPFGGRNAPRKTSEVHWLKPE
LVAEIEFAGFTGAGMVRQAAFKGLRQDKPAEEVEAETPVRTEVAEPRVKGAAKKSARPAA
KPGSGNANVMGVAISKPDKQLWPDGGDGEPVTKLDLARYYEAVGDWMLPHIKGRPCSIVR
APDGISGEQFFQRHAMAGSSNLLNLVSVSGDRKPYLQIDRIEGLAAVAQIGGVELHAWNC
AENAPEQPGRLVFDLDPAPDVGFDAVIATARELRERLEALGLVSFCKTTGGKGLHVVTPL
AQSKAELGWKEAKAFAQTVCARMAEDSPERYLLNMAKAKRKGKIFLDYLRNDRMSTAVAV
LSPRAREFATVSMPLTWPQVKAGLDPKRYTLRTVLALLKKTKAWSDYAAAAAPLQAAIKK
LAASGAG
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgttccagcctgaatctctatcgcaagaagcgcgatttcgagcagaccgccgaa
ccctccggcgaggcgccggtggcgccgtcgaagcggcggcgcttcgtgatccagaaacac
gacgccacgcggctgcactacgatctgcggctggaattcgacggcgtgttcaaatcctgg
gcggtgacgcgcgggccctcgctcgatccgcacgacaagcggctcgcggtcgaggtcgag
gaccatccgctcgactacggcgacttcgaaggcaccattcccaaggggcaatatggcggc
ggcaccgtgatgctgtgggaccgcgggttttgggagtgcgacgaccccgaacgcggcttc
aagaacggcgatctgaaatttaccctggagggcgacaagctgcacggcggcttcgtgctg
gtgcggatgaagcacgaccgctcaggcggcaagcgcaccaactggctgttgatcaagcat
cgcgacgaattcgcccgcgagggcgatgccgacggcattttggacgaggaccgctcggtc
gcctcgggccgcgcgatggcggagatcgccgccggcaagggccgcgcgccaaaaccgttc
atgctgcgcaaatcggcgcgcgccaaggccgacgcggtgtggaattccaaccgcggcgag
gcggccgaggcgcgcaacgccagcgcatcggccgcgcgcaaatccgcgccgctcaaggag
acgccctccaaatccacggcacggcggccgaagcgcgcggcgtcgagcgctagcgcgatg
gcgcgtagcggcaagcccgcgccgatgccggatttcgtggcgccgcagctctgtacttcc
ttggagcggccgcccggcggcgccggctgggttcacgagatcaagttcgacggctatcgc
gtgcaactgcgcgtcgagaacggcagggccgtgctcaacacccgcaaagggctggactgg
acggcaaaattcaaggccatcgcgcaacaggcggcgtcgctgcccgacgccatcatcgac
agcgagatcgtcgcgctcgatcataagggcgcgccggatttcgccgcgttgcaggcggcg
ctgtcggacggggcgaccgacgatctgatctgtttcgcgttcgatctgttgtacgccgaa
ggcgaggatctgcggcggctgccgctatccgaacgcaaggcgcggctgaaacagatgctc
gacgccgcgcgcggccggcgcaaggacggcctgatccgctatgtcgaacatttcgagacc
ggcggcgacgcggtgctgcaatcggcctgccagatgtcgctggaaggcatcgtttcgaaa
aagctcgccgcgccgtatcgctccggccgcaccgatgcctggaccaaatcgaaatgccgc
gccgggcacgaggtggtgatcggcggctggaagagcaatgccggcaaattccgctcgctg
ctggtgggcgtccatcgcgacgatcatctggcgtatgtcggcgtggtcggtaccggcttc
ggccgcgacatggtgagacgcatcatgccggcgctcgaggctgcggccgccgaccaaaat
ccgttcgggggccgcaacgcgccgcgcaagacctccgaggtgcattggctcaagcccgaa
ttggtagccgagatcgaattcgccggcttcaccggcgccggcatggtgcggcaggccgcg
ttcaaggggctgcggcaggacaagccggcggaggaggtcgaggccgagacgccggtgcgc
acggaagtcgccgagccgcgggtcaagggtgcggccaagaagtccgcacgccccgccgcc
aagcccggcagcggcaacgccaatgtgatgggcgtggcgatctcaaaacccgacaagcag
ctgtggccggatggcggcgacggcgagccggtgaccaagcttgatctggcgcgctattat
gaggcggtcggcgactggatgctgccgcatatcaagggccggccatgctcgatcgtgcgc
gcgccggacggcatttcgggcgagcagttttttcagcgccacgcgatggcgggcagttcc
aatctgctcaacctggtcagcgtctccggtgaccgcaagccctatctgcagatcgatcgg
atcgaggggctggcggcggtggcgcagatcggcggcgtcgagctgcacgcctggaattgc
gccgagaacgcgcccgagcagcccgggcgtttggtgttcgatctcgatcccgcgccggac
gtcggcttcgatgcggtgatcgctaccgcgcgcgaactacgcgagcggctggaggcgctg
gggctggtcagcttctgcaagaccaccggcggcaaggggctgcatgtggtgacgccgctg
gcgcagagcaaagccgagctcggctggaaggaggcaaaagccttcgcgcaaaccgtgtgc
gcgcggatggccgaggacagcccggagcgctatctgctcaacatggcgaaggccaagcgc
aagggaaagatcttcctggactatctgcgcaacgaccggatgtcgaccgcggttgcggtg
ctgtcgccgcgggcgcgcgaattcgccacggtgtcgatgccgctgacctggccgcaggtc
aaggccggtctcgaccccaaacgctacacgctgcgcaccgtgctggcgctgttgaagaag
accaaagcatggtccgactacgccgccgcggcggccccgctgcaggccgcgatcaagaag
ctcgcggcgagcggggccgggtag

DBGET integrated database retrieval system