KEGG   Ralstonia pickettii 12D: Rpic12D_0479Help
Entry
Rpic12D_0479      CDS       T00925                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00010  Glycolysis / Gluconeogenesis
rpf00230  Purine metabolism
rpf00620  Pyruvate metabolism
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
rpf01120  Microbial metabolism in diverse environments
rpf01130  Biosynthesis of antibiotics
rpf01200  Carbon metabolism
rpf01230  Biosynthesis of amino acids
Module
rpf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rpf_M00002  Glycolysis, core module involving three-carbon compounds
rpf_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
rpf_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic12D_0479
   00620 Pyruvate metabolism
    Rpic12D_0479
  Nucleotide metabolism
   00230 Purine metabolism
    Rpic12D_0479
Enzymes [BR:rpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Rpic12D_0479
Membrane trafficking [BR:rpf04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Rpic12D_0479
Exosome [BR:rpf04147]
 Exosomal proteins
  Proteins found in most exosomes
   Rpic12D_0479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C DUF3006 IMPDH
Motif
Other DBs
NCBI-ProteinID: ACS61785
JGI: Rpic12D_0479
UniProt: C6BCS4
LinkDB All DBs
Position
1:502982..504421
Genome map
AA seq 479 aa AA seqDB search
MTRATKIVATLGPASSTQEVLTRMIAAGVDVVRLNFSHGAAQDHIDRAQLVREVARSVGR
EVAIMADLQGPKIRVGKFENGKITLEPGDRFTLDARCELGNQERVGLDYKELPRDVGPGD
LLLLNDGLIVLQVERVVGEEIETIVKIGGDLSNNKGINRQGGGLSAPALTAKDMEDIKTA
MALGADYVAVSFPKNATDMEMARQLAAVAGAPHNHKTRMIAKIERAEAIRPGVLEEILAA
SDGIMVARGDLAVEVGNAAVPALQKRMIKLARENNKLAITATQMMESMIVNPVPTRAEVS
DVANAVLDGTDAVMLSAETAAGRYPVETIEAMAAICVEAEKSQTVHLDADFLDQTFSRID
QSIAMGALFTAHHLQVKAIAALTDSGATALWMSRHGINIPIYAMTPNVASQRKMALYRNV
QSLPLANSTDRDEALHQAEELLVARGVVQRGDFIVLTVGEPMGQAGGTNTLKIVRVGMH
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgctaccaagatcgtcgcaacgctcggccccgcgtccagcacgcaggaagtc
ctgacccgcatgatcgctgcgggggtcgacgtggtgcggctgaacttctcgcacggcgcg
gcgcaagaccacatcgatcgcgcgcagctggtgcgcgaagtggcgcgttcggtcggccgc
gaggtggccatcatggccgacctgcagggcccgaagatccgggtcggcaagttcgagaac
ggcaagatcacgctcgagccgggtgatcgcttcacactggatgcccgctgcgagctgggc
aaccaggagcgcgtcggtctcgactacaaggaactgccgcgcgacgttggccccggtgat
ttgctgctgctcaacgacggcctgatcgtgctgcaggtcgagcgcgtggtgggtgaagag
atcgagaccatcgtcaagatcggcggcgatctctccaacaacaagggcatcaaccgccag
ggcggcgggttgtcggcgccggcgctgacggccaaggacatggaagacatcaagaccgcg
atggccctcggcgccgattacgtcgcggtcagcttccccaagaacgcgaccgacatggag
atggcccgccaactggctgccgtggccggtgcgccgcataaccacaagacccgcatgatc
gccaagatcgagcgtgccgaggccatccgtccgggcgtgctcgaagagatcctggccgcc
tccgacggcatcatggtcgcgcgtggcgacctggccgtggaagtgggcaacgcggccgtg
ccggcgctgcagaagcgcatgatcaagctggcccgcgaaaacaataagctggccatcacc
gccacgcagatgatggaatcgatgatcgtcaacccggtgccgacgcgcgccgaggtgtcg
gacgtcgccaacgccgtgctcgacggtaccgatgccgtgatgctgtcggcggaaaccgcc
gccggccgctaccccgtcgagaccatcgaagccatggctgccatctgcgtcgaagccgag
aagtcgcaaaccgtgcatctggatgcagacttcctcgaccagaccttcagccgtatcgac
cagtcgattgccatgggcgcactgttcacggcgcaccacctgcaggtcaaggcgattgcc
gcgctcaccgattccggcgcgacggcgctctggatgagccgccacggcatcaacatcccc
atttatgcgatgacgcccaacgtggcctcgcaacgcaagatggccctgtaccgcaacgtg
cagtcgctcccgctggccaacagcaccgaccgcgacgaagccctgcaccaggccgaagaa
ctgctggtcgcgcgcggcgtcgtgcagcgtggcgacttcatcgtcctcaccgtcggcgag
ccgatgggccaggccggcggcaccaatacgctcaagattgttcgcgtcggcatgcactga

DBGET integrated database retrieval system