KEGG   Ralstonia pickettii 12D: Rpic12D_0479Help
Entry
Rpic12D_0479      CDS       T00925                                 

Definition
pyruvate kinase (EC:2.7.1.40)
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpic12D_0479
   01230 Biosynthesis of amino acids
    Rpic12D_0479
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic12D_0479
   00620 Pyruvate metabolism
    Rpic12D_0479
  Nucleotide metabolism
   00230 Purine metabolism
    Rpic12D_0479
Enzymes [BR:rpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Rpic12D_0479
Exosome [BR:rpf04147]
 Exosomal proteins
  Proteins found in most exosomes
   Rpic12D_0479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:502982..504421
Genome map
AA seq 479 aa AA seqDB search
MTRATKIVATLGPASSTQEVLTRMIAAGVDVVRLNFSHGAAQDHIDRAQLVREVARSVGR
EVAIMADLQGPKIRVGKFENGKITLEPGDRFTLDARCELGNQERVGLDYKELPRDVGPGD
LLLLNDGLIVLQVERVVGEEIETIVKIGGDLSNNKGINRQGGGLSAPALTAKDMEDIKTA
MALGADYVAVSFPKNATDMEMARQLAAVAGAPHNHKTRMIAKIERAEAIRPGVLEEILAA
SDGIMVARGDLAVEVGNAAVPALQKRMIKLARENNKLAITATQMMESMIVNPVPTRAEVS
DVANAVLDGTDAVMLSAETAAGRYPVETIEAMAAICVEAEKSQTVHLDADFLDQTFSRID
QSIAMGALFTAHHLQVKAIAALTDSGATALWMSRHGINIPIYAMTPNVASQRKMALYRNV
QSLPLANSTDRDEALHQAEELLVARGVVQRGDFIVLTVGEPMGQAGGTNTLKIVRVGMH
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgctaccaagatcgtcgcaacgctcggccccgcgtccagcacgcaggaagtc
ctgacccgcatgatcgctgcgggggtcgacgtggtgcggctgaacttctcgcacggcgcg
gcgcaagaccacatcgatcgcgcgcagctggtgcgcgaagtggcgcgttcggtcggccgc
gaggtggccatcatggccgacctgcagggcccgaagatccgggtcggcaagttcgagaac
ggcaagatcacgctcgagccgggtgatcgcttcacactggatgcccgctgcgagctgggc
aaccaggagcgcgtcggtctcgactacaaggaactgccgcgcgacgttggccccggtgat
ttgctgctgctcaacgacggcctgatcgtgctgcaggtcgagcgcgtggtgggtgaagag
atcgagaccatcgtcaagatcggcggcgatctctccaacaacaagggcatcaaccgccag
ggcggcgggttgtcggcgccggcgctgacggccaaggacatggaagacatcaagaccgcg
atggccctcggcgccgattacgtcgcggtcagcttccccaagaacgcgaccgacatggag
atggcccgccaactggctgccgtggccggtgcgccgcataaccacaagacccgcatgatc
gccaagatcgagcgtgccgaggccatccgtccgggcgtgctcgaagagatcctggccgcc
tccgacggcatcatggtcgcgcgtggcgacctggccgtggaagtgggcaacgcggccgtg
ccggcgctgcagaagcgcatgatcaagctggcccgcgaaaacaataagctggccatcacc
gccacgcagatgatggaatcgatgatcgtcaacccggtgccgacgcgcgccgaggtgtcg
gacgtcgccaacgccgtgctcgacggtaccgatgccgtgatgctgtcggcggaaaccgcc
gccggccgctaccccgtcgagaccatcgaagccatggctgccatctgcgtcgaagccgag
aagtcgcaaaccgtgcatctggatgcagacttcctcgaccagaccttcagccgtatcgac
cagtcgattgccatgggcgcactgttcacggcgcaccacctgcaggtcaaggcgattgcc
gcgctcaccgattccggcgcgacggcgctctggatgagccgccacggcatcaacatcccc
atttatgcgatgacgcccaacgtggcctcgcaacgcaagatggccctgtaccgcaacgtg
cagtcgctcccgctggccaacagcaccgaccgcgacgaagccctgcaccaggccgaagaa
ctgctggtcgcgcgcggcgtcgtgcagcgtggcgacttcatcgtcctcaccgtcggcgag
ccgatgggccaggccggcggcaccaatacgctcaagattgttcgcgtcggcatgcactga

DBGET integrated database retrieval system