KEGG   Ralstonia pickettii 12J: Rpic_0240Help
Entry
Rpic_0240         CDS       T00762                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01801  
maleylpyruvate isomerase [EC:5.2.1.4]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Tyrosine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rpic_0240
Enzymes [BR:rpi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.4  maleylpyruvate isomerase
     Rpic_0240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:255236..255886
Genome map
AA seq 216 aa AA seqDB search
MSIKLYNYFRSSASFRVRIALEVKGLPYDYAPVHLLKGEQLAPDFVKLNPDALVPVLCDG
NDVLNQSLAIVEYLEETHPEPTLLPGSASNRAHIRAIALAIACEIHPLNNPRVLKYLKHT
FNVEEEARNEWYRHWVKLGFAALETRLSQSPLTGAYCVGDTPTLADVCLVPQVFNGKRFD
VAVEDYPTLARIFAHCMAQEAFQRAAPAAQPDAVSA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcaagctgtacaactatttccgcagttcggcgtcattccgcgtgcgtattgcc
ctggaggtcaagggcctgccgtacgactacgcgccggtccacctgctcaagggcgagcaa
ctggcccccgacttcgtcaagctgaaccccgatgcgctggtgcccgtgctgtgcgatggc
aacgacgtgctgaaccagtctttggccatcgtcgagtatctggaagagacgcatcccgag
cccacgctgctgccgggttcggcgagtaatcgcgcgcatatccgcgcgatcgcgctggcc
attgcatgcgagatccatccgctcaacaacccacgcgtgctgaagtatctgaagcacacg
ttcaacgtggaagaagaagcgcgcaacgagtggtatcgccactgggtgaagctggggttt
gcggcgctggaaacgcggctgtcacagtcgccgctgaccggtgcctactgtgttggcgac
acgccaacgctggccgacgtgtgcctcgtgccgcaggtgttcaacggcaagcggttcgat
gtggcggtggaagattacccgacgcttgcgcgcatctttgcgcactgtatggcgcaggag
gcgtttcagcgggctgcgcctgcggcgcagccggatgcggtttccgcgtaa

DBGET integrated database retrieval system