KEGG   Ralstonia pickettii 12J: Rpic_2167Help
Entry
Rpic_2167         CDS       T00762                                 

Definition
(GenBank) putative GST-related protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Rpic_2167
Enzymes [BR:rpi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Rpic_2167
Transporters [BR:rpi02000]
 Other Transporters
  Pores ion channels [TC:1]
   Rpic_2167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C_2 GST_N GST_N_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: ACD27301
UniProt: B2U7L4
LinkDB All DBs
Position
1:complement(2280334..2280987)
Genome map
AA seq 217 aa AA seqDB search
MLTLYGFAASNYYNKVKLALMEKGIAFEESLRWPDQTDGEVSPLHKVPYLVGEDGGMCES
QVILDYLEARYPQHPLIPADPFKAAKVREIVTFLELHLELVARQLFPEAFFGGKISDNLK
VKVREQLQKNIPAAAKLFKFSPYVAGDTFTIADCAAIVHFPLVSQATKIIYGEDLLAQVE
GVKPYLAKMAENPNVQKVRADSKANLEQMLAHYASKR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgctatacggttttgccgcgagcaactactacaacaaggtcaagctcgcgctg
atggagaaggggattgcgttcgaggaatcgctgcgctggccggaccagaccgacggcgag
gtgtcgccgctgcacaaggtgccgtatctcgtgggcgaggacggtggaatgtgcgaatcg
caggtcatcctcgattacctggaggcgcgctacccacaacatccgctgattccggccgat
ccgttcaaggcggccaaggtgcgtgagattgtcacgttcctggagctgcatctggaactg
gtcgcgcgccagctgtttcccgaagcgttcttcggcggcaagatcagcgacaacctgaag
gtcaaggtgcgcgaacaactgcagaagaacatcccggcggcggccaagctgttcaagttc
tcgccttacgtagcgggcgacacgttcaccatcgccgactgcgcggccatcgtgcacttc
ccgctggtgagtcaggccaccaagatcatctacggtgaagacctgctggcgcaggtcgaa
ggcgtcaagccttacctggccaagatggccgagaatcccaacgtgcagaaagtgcgggca
gacagcaaggccaatctcgagcagatgcttgcgcactacgccagcaagcgctga

DBGET integrated database retrieval system