KEGG   Ralstonia pickettii DTP0602: N234_14310Help
Entry
N234_14310        CDS       T03172                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rpj  Ralstonia pickettii DTP0602
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpj00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    N234_14310
Enzymes [BR:rpj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     N234_14310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:3081596..3083200
Genome map
AA seq 534 aa AA seqDB search
MQRITTPIEPPKRAALLATLEREPRWDVIVIGGGATGLGTAVDAASRGYRTLLVEAADFA
KGTSSKATKLVHGGVRYLAQGNISLVREALHERGLLARNAPHLVWPLGFVVPAYQMFDQP
FYGIGLKVYDMLAGNLNLAGSRWLNHREVLAAAPNLAEHVSGRPLRGGNLYFDGQFDDAR
LAVALMRTLFDVGGTAVNYMRVTGLSQQGGVISGVTVQDVLGDATFRLRADCVINATGVW
VDAIRQMEDGHARTMVAPSQGVHLTLPRSFNPGGRAILIPKTDDGRVLFVVPWNGHTIVG
TTDTPRRDLPLEPDAGADDVDFILETASRYLAKDPTRADVTSVWAGLRPLVKATGEASTA
SLSREHTILVSKAGLITVTGGKWTTYRKMAEDVIETAIQRQMVRAAPCVTAELPLHGAAG
LPSDLPPPDSVSPDRYYGNELETLRALPGYDRMLAPASGLTEAHVRFAARHELARRVEDV
LARRNRVLFLDARAAVAAAPAVAAILAEELGENEAWQAREIESFRALAAGYMLG
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaatcaccacaccgatcgagccccccaagcgcgccgccctgctcgccaccctg
gagcgcgagccgcgctgggacgtgatcgtcatcggcggcggcgccaccggcctcggcacc
gcggtcgacgccgcctcgcgcggctaccgcacgctgctggtcgaagccgccgattttgcc
aaaggcacctcgagcaaggccaccaagctggtccatggcggcgtgcgctacctggcccag
ggcaatatcagcctggtgcgcgaggcactgcacgagcgcggcctgctggcgcgcaacgcc
ccgcacctggtgtggccgctgggtttcgtggtaccggcgtaccagatgttcgaccagccc
ttctacggcatcggcctgaaggtctacgacatgctggccggcaacctcaacctggccggc
agccgctggctgaaccaccgcgaggtgctggccgcggcgcccaacctggccgagcatgtc
agcggacgtccgctgcgcggcggcaacctgtacttcgatggccagttcgacgatgcgcgg
ctggcggtggcgctgatgcgcacgctgttcgacgtcggcggcaccgcggtcaactatatg
cgcgtgaccggactgagccagcaaggcggcgtgatcagcggcgtcacggtgcaggacgtg
ctgggcgacgccaccttccggctgcgcgcggactgcgtgatcaatgccaccggggtctgg
gtcgacgccatccgccagatggaagacggccacgcgcgcaccatggtcgcgcccagccag
ggcgtgcacctgacgctgccgcgcagcttcaatcccggagggcgcgccatcctgatcccc
aagaccgacgacgggcgcgtgctgttcgtggtgccgtggaacggccacaccatcgtcggc
accaccgacacgccgcgccgcgacctgccgctggaaccggacgccggcgctgacgatgtc
gatttcatcctggagaccgcatcgcgctacctggccaaggatcccacgcgcgccgacgtc
accagcgtctgggccgggctgcggccgctggtcaaagccaccggcgaggcgtcgaccgca
tcgctgtcgcgcgagcatacgatcctggtgtccaaggccggtctgatcaccgtcaccggc
ggcaagtggaccacctaccgcaagatggccgaggacgtgatcgaaaccgcgatccagcgc
cagatggtgcgcgccgcgccctgcgtgaccgccgaactgcccctgcacggcgccgcgggc
ctgccgtcggacctgccgccgccggactcggtatcgccggaccgctactacggcaacgag
ctggaaacgctgcgcgccctgcccggctacgaccggatgctggcgcccgcgtccgggctg
accgaggcccatgtgcgcttcgccgcccggcacgagctggcccggcgcgtcgaggacgtg
ctggcgcgccgcaaccgcgtgctgttcctggacgcacgcgccgccgtggcagccgcgccg
gccgtggccgcgatcctggccgaggaactcggcgagaacgaagcctggcaggcgcgcgag
atcgaaagcttccgcgcacttgccgccggctacatgctgggctga

DBGET integrated database retrieval system