KEGG   Ralstonia pickettii DTP0602: N234_16175Help
Entry
N234_16175        CDS       T03172                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rpj  Ralstonia pickettii DTP0602
Pathway
rpj00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rpj00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    N234_16175
Enzymes [BR:rpj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     N234_16175
Transporters [BR:rpj02000]
 Other Transporters
  Pores ion channels [TC:1]
   N234_16175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_4 GST_C_3
Motif
Other DBs
NCBI-GeneID: 17103141
NCBI-ProteinID: AGW91567
UniProt: U3QU13
LinkDB All DBs
Position
1:complement(3476202..3476855)
Genome map
AA seq 217 aa AA seqDB search
MSKTILTISSKTYSSWSLRGWLLARFAGLEFEEVLVPPDDAAARAEILLLSPSILVPCLR
HQGVTVWDTLAIAEYLNEIRPKAGLLPEDRAARAHCRAICGEMHSGFAAMRSALPMNLKG
HFPGMKVWSRAQADIDRITAIWTECLTRYGGPYLFGTRTMADAMYAPVVTRFVTYGVMLD
PEPVAYCKQILSMPELQEWIAAAREEPDEISELDVEF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccatactcacaatcagcagcaagacctattcttcgtggtcgctgcgcggc
tggttgctggcgcgctttgccggcctggaattcgaggaagtgctggtgccgcccgacgac
gccgcggcgcgtgccgagatcctgctgctgtccccgtcgatcctcgttccctgcctgcgc
caccagggcgtgacggtgtgggacacgctggcgatcgccgaatacctgaacgagatccgc
cccaaggccggcctgctgccggaagaccgcgccgcgcgcgctcactgccgcgccatttgt
ggcgagatgcactcagggtttgccgcgatgcgctcggcgctgccgatgaacctgaaaggg
catttcccggggatgaaggtgtggtcgcgtgcgcaggcggacattgaccgcatcacggcg
atctggaccgaatgcctgacccgctacggcgggccgtacctgttcggcacgcgcaccatg
gccgatgccatgtacgcgccggtggtgacgcgctttgtcacctacggcgtgatgctcgat
ccggagccggtcgcctattgcaagcagatcctgtcgatgccggagctgcaggaatggatc
gcggcggcgcgcgaggaacccgacgaaatcagcgaactggatgtggagttctag

DBGET integrated database retrieval system