KEGG   Ralstonia pickettii DTP0602: N234_31065Help
Entry
N234_31065        CDS       T03172                                 

Gene name
gabD
Definition
(GenBank) succinate-semialdehyde dehdyrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
rpj  Ralstonia pickettii DTP0602
Pathway
rpj00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:rpj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    N234_31065 (gabD)
Enzymes [BR:rpj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     N234_31065 (gabD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-GeneID: 17106112
NCBI-ProteinID: AGW94487
UniProt: U3R253
LinkDB All DBs
Position
2:complement(2194637..2196082)
Genome map
AA seq 481 aa AA seqDB search
MTVFLNHIDGEWTACQSGRTFDNVNPADTADIVGRFQASSAVDAQAAVAAAAAAFAGWKK
TPVGKRAAILNRAADHLEANADSIAAELTREEGKALALARDEVLRSAQTLRFYAVEGQTF
TGEVYPNDDPDQLVYSQREPLGVVTVIAPWNFPVSIPARKIAPALVTGNTVVFKPSSEAP
LSGYRLAEALVKAGLPKGVLNFITGSAAEIGPAITEAPAVRAISFTGSSRAGEQIHRAVP
LTTRTQMELGGKNPLIVMEDADLDRAVDLTIKGGFSLSGQACTGTSRVLVAESVKAAYTE
RLLAKVATLKVGSGMTAGMDLGPLASHKQLETVLRYIDIGKSEATLLCGGARLAGGDFDK
GYYVAPTVFTDVTQQMRIAREEIFGPVIAILGFTDYADAIAKANDTEYGLAAAIVTSNPR
YIHHFATDIEAGTVKVNRTTTGNLVNAPFGGVKRSSTSTFRESGRTGLEFYTQVKTVYRG
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtattcctcaaccatatcgacggcgaatggacggcctgccagtcgggccgtacc
ttcgacaatgtcaacccggccgataccgccgatatcgtgggccgcttccaggcgtcttcc
gcggtggacgcgcaggcggccgtcgccgccgcggcggcagcgttcgccggctggaagaaa
actccggtcggcaagcgcgccgccatccttaaccgcgccgccgatcatcttgaagccaat
gccgacagcattgccgccgagctgacccgcgaggaaggcaaggcgctggcactggctcgc
gacgaggtgctgcgctcggcccagacgctgcggttctacgcggtggaagggcagaccttc
accggcgaggtgtacccgaacgacgaccccgaccagctcgtctacagccagcgcgagccg
ctgggcgtggtgacggtgatcgcgccgtggaatttcccggtgtcaatcccggcgcgcaag
atcgccccggcgctggtgaccggcaacacggtggtgttcaagccgtcgtccgaggcgccg
ctgtcgggctaccggctggccgaggcactggtcaaggccggcctgcccaagggcgtgctg
aacttcatcaccggcagcgcggccgagatcggcccggccatcaccgaggcgccggctgtg
cgggcgatctcgttcaccggctcgtcgcgcgccggcgagcagatccaccgcgccgtgccg
ctgaccacgcgcacgcagatggagctgggcggcaagaatccgctgatcgtgatggaagat
gccgacctcgaccgcgccgtcgatctgaccatcaagggcggcttctcgctgtcggggcag
gcgtgtaccggcaccagccgcgtgctggtggccgagtccgtcaaggccgcgtacaccgag
cggttgctggcgaaggtcgccacgctcaaggtcggcagcggcatgacggccgggatggac
ctcgggccgctggcctcgcacaagcagctggaaacggtgctgcgctatatcgatatcggc
aagtccgaagcgacgctgctgtgcggcggcgcgcgcctcgccggcggcgactttgacaag
ggctactacgtggcgccgaccgttttcaccgacgtgacccagcagatgcggatcgcgcgc
gaggagatcttcgggccggtgatcgccatcctgggcttcaccgactacgccgacgccatc
gccaaggccaacgacaccgagtacgggctggccgcggccatcgtcaccagcaacccgcgc
tacatccaccacttcgccacggacatcgaggcgggcacggtcaaggtcaaccgcaccacc
accggcaatctggtcaacgcgccgttcggcggggtgaagcgctcaagcacctcgaccttc
cgcgagtcgggccgcaccgggctggagttctatacgcaggtcaagacggtctatcggggc
gcctga

DBGET integrated database retrieval system