KEGG   Ralstonia pickettii DTP0602: N234_32165Help
Entry
N234_32165        CDS       T03172                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
rpj  Ralstonia pickettii DTP0602
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:2396451..2399297
Genome map
AA seq 948 aa AA seqDB search
MKEDSSPRQNYEDALLGIVREMSSAMRPPAEGEVAVSLDSTLEGELGFDSLTRAELLTRL
EQRFGVSLPEQVLAQADTPRALLRALLAAKDLPPEASGAHLRQARPAPAAQAPEGAATLP
DVLRWHLRSHPDRTHIILQDGDGEDTQISFAQLHRRAAAIAAGLVSRGVRAGTAVAIMLP
TSPGYFYSFCGVLLAGGIPVPLYPPARLAQIGDHLQRHAGILANAQAPILITVAQARPLA
ALLKASTGTLQGVLTPEELEDGAGAPVHAMLRTHDIALLQYTSGSTGSPKGVVLSHANLL
TNLRAMGKTLAVGSQDVFVSWLPLYHDMGLIGAWLGSLYYAYPLVVMSPLAFLARPERWL
WAIHKYRGTLSGGPNFAYELCLRKLANADLAGLDLSSWRFAFNGAEPVSLQTMRAFMERF
ARYGLRPQAAAPVYGLAEASLGLTFPPLGRGLASDRIDRAEFTRTSVAVPAGEREIPGER
ETLEFPSCGRPLDGHEVRIVDATGRELAERHEGLLQFRGPSATTGYFRNPVQTRQLFDRG
WLNTGDYAYIAADEVFITGRAKETIVRGGRNIYPYELEQAVGAIPGIRKGCVAVFGSPDP
DSGTERIVVMAETSEKDVQARRALHRQALKTALDVLGMPPDHIALVPPHTILKTSSGKIR
RAACRERFEHGRPGRGVEAPWLQIARFGWRALWPELRRGRQTAVGLSYALYTWILFATLA
PVTWLASVALHRPTLGWALSHHAARLFLRLGAVPWFVQGIEHLPRDRPCILVSNHASYLD
GIVLVAALPTPVCMVAKRELQGQRIPGAYLASIGADFIDRFDNVREHEDVERVVATVRAG
HSALFFPEGTFGRAPGLQAFRSGAFLAAARAGAPVVPIAIRGTRSVLRDGQWLPRRGPIG
VVIGSPLWPDGEDWPAAMRLRNTARAEILHYCGEPDARRMTHRDARRA
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggattcctccccgaggcagaactacgaggatgccctgctcggcatcgtgagg
gagatgtcttcggcaatgcgcccgccagccgagggcgaggtagcggtttcgctggacagc
accctcgaaggcgaactgggtttcgacagcctgacgcgtgccgagctgctgacccgcctc
gagcagcgcttcggcgtcagcctgccggagcaggtgctggcccaggccgacaccccgcgc
gccctgctgcgtgccttgctcgccgccaaggacctgccgccagaagcgagcggcgcacac
ctgcggcaagcccgccctgccccggcggcacaggcgcccgagggcgccgccaccttgccg
gacgtgctgcgctggcacttgcgcagccacccggaccgcacccacatcatcctgcaggac
ggcgacggcgaagacacgcagatcagctttgcgcagctgcaccgccgcgccgcggccatc
gccgccgggctggtgtcccgcggcgtgcgggcgggcacggcagtggccatcatgctgccc
accagccccgggtacttctacagtttctgcggcgtgctgctggcgggcgggattccggta
ccgctctacccgccggcgcggctggcgcagatcggcgaccacctgcagcgccacgccggc
atcctggccaacgcgcaggcgccgatcctgatcacggtggcccaggcgcggccgctggcc
gccctgctcaaggccagcacgggaacgctgcaaggcgtgctcacgccggaggagctggag
gacggcgccggcgccccggtccatgcgatgctgcgcacgcacgacatcgccctgctgcaa
tacacctcgggcagcaccggctcgcccaagggggtcgtgctcagccatgccaacctgctg
accaaccttcgcgccatgggcaagaccctggccgtcggctcgcaggacgtctttgtcagc
tggctgccgctctatcacgacatgggcctgatcggcgcctggctgggcagcctgtactac
gcgtacccgctggtggtgatgtcgccgcttgccttcctggcgcggcccgagcgctggctc
tgggcgatacacaagtaccgtggcacgctctcgggcgggcccaactttgcctacgagctg
tgcctgcgcaagctggccaacgccgatctggccgggctggacctttccagctggcgcttc
gccttcaatggcgcggagccggtgagcctgcagaccatgcgcgccttcatggagcgcttt
gcccgctacggtttgcgcccgcaggccgcggcgccggtgtacgggctggcggaggcttcg
ctgggcctgacctttccgccgctgggccgcggactggcgtccgaccgcatcgaccgtgcc
gaattcacgcgcacttccgtggcagtgcccgccggcgaacgcgagatccctggcgagcgc
gagaccctggaattcccgtcctgtggccggccgctggacggccacgaagtccgcatcgtc
gacgccaccgggcgcgaactggccgagcggcatgagggattgctgcagttccgcggccct
tcggccaccaccggctatttccgcaatcccgtgcagacccgccagttgttcgaccgcggc
tggctgaacacaggggactatgcctatatcgccgccgatgaggtctttatcaccgggcgc
gccaaggagaccatcgtgcgcggcggccgcaatatctatccctacgagctggagcaggcc
gtcggcgccatcccgggcatacgcaagggctgcgtggccgtgttcggcagtcccgatccg
gatagcggcaccgaacgcatcgtggtgatggcggaaacctccgagaaggatgtgcaggcg
cgccgcgcgctgcaccggcaggcgctgaagaccgccctcgacgtgctgggcatgccgccc
gaccatatcgccctggtgccaccgcacaccatcctgaagacgtcgagcggcaagatccgg
cgcgccgcctgccgcgagcgcttcgagcacggacgccccggccgcggcgtggaagcgccc
tggctgcagatcgcgcgctttggctggcgggcgctgtggccggagctgcggcgtggccgg
cagaccgccgtgggcctgtcatatgccctctacacctggatcctgttcgcaacgctggcg
ccggtgacctggctggcatcggttgcgctgcaccggccgacactgggctgggcgctcagc
caccacgccgcccggctttttctcaggctgggcgcggtaccctggttcgtgcaagggatt
gagcacctgccgcgcgaccggccctgcatcctggtctcgaatcacgccagctacctggac
ggcatcgtgctggtggcggcgctgcccacgccggtatgcatggtcgccaagcgcgaactg
cagggccagcgcatccccggcgcctacctggccagcatcggcgccgacttcatcgaccgc
ttcgacaacgtgcgcgagcacgaggacgtggagcgcgtggtggccacggtgcgtgccggg
cattcggcgctgttcttccccgaaggcaccttcgggcgggcgccggggctgcaggccttc
cgctcgggcgctttcctggcggccgcgcgggccggcgcgccggtggtgcccatcgccatc
cgcggcacccgctcggtgctgcgcgacggccagtggctgccgcgccgggggccgatcggc
gtggtcatcggcagcccgctctggccggacggcgaagactggccggccgccatgcgcctg
cgcaataccgcccgcgccgagatcctgcattactgcggcgaaccggatgcccggcgcatg
acgcaccgcgatgcgaggcgggcctag

DBGET integrated database retrieval system