KEGG   Raoultella planticola: B1209_01545Help
Entry
B1209_01545       CDS       T05298                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rpln  Raoultella planticola
Pathway
rpln00250  Alanine, aspartate and glutamate metabolism
rpln00410  beta-Alanine metabolism
rpln00640  Propanoate metabolism
rpln00650  Butanoate metabolism
rpln01100  Metabolic pathways
rpln01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpln00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    B1209_01545
   00650 Butanoate metabolism
    B1209_01545
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B1209_01545
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B1209_01545
Enzymes [BR:rpln01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     B1209_01545
Amino acid related enzymes [BR:rpln01007]
 Aminotransferase (transaminase)
  Class III
   B1209_01545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AUV51713
LinkDB All DBs
Position
337183..338448
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCNYFVEKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
IVAAVAQQLEAFTHTAYQIVPYESYVSLAERINALAPVDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHGVYPNAAHGITTD
EAMKSLERIFKADIAPDQVAAIILEPIQGEGGFNVAPAEFMQALRTLCDTHGILLIADEV
QTGFARTGKLFAMQHYDVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIEEEQLCQRAEQLGSHLKEVLNQAREYCPAIVDIRGQGSMVAVEFND
PQTGAPSPEFTRHIQQKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFTKALDILARVLK
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagttcagaactgaatcaacgtcgccagcaggcgacgccgcgcggcgtaggcgta
atgtgcaattactttgttgagaaggcggagaatgccacgctgtgggatgtggaaggcaat
gaggtgattgattttgctgcgggaattgccgtgctcaataccggccatcgccacccgaaa
attgttgccgccgtcgcgcagcagctggaggcctttacccatacggcgtatcagattgtc
ccttacgaaagctatgtctcgctggcggagcgcattaacgcgctggcgccggttgatggc
ccggccaaaaccgctttcttcaccaccggtgcggaagccgtggaaaacgcggtgaagatt
gcccgcgcttataccggtcgtccggggctgattacttttggcggcggttttcatggccgt
acctttatgaccatggcgctgaccggtaaggtcgcaccttacaaaatcggttttggaccg
ttccctggttcggtctatcacggggtatacccgaatgctgcccacggcattaccaccgat
gaggcgatgaaaagccttgagcgtatctttaaagccgatatcgctccggaccaggtggcg
gcaattatcctcgaaccgattcagggcgaaggcggttttaacgtcgcgccagcggagttt
atgcaggcgctgcgtacgctgtgcgatacccacggcatcctgctgattgccgatgaagta
cagaccggttttgcccgtaccggcaagctgtttgccatgcagcattacgatgtgaagccg
gacctgatgacgatggcgaaaagccttgccggcggtttcccgctgtctggcgtagtgggg
cgcgccgaggtgatggatgcgccggcgccgggcggactgggcggcacttatgccggtaac
ccgctggcggtcgctgcggctcatgcggtccttgacgtcatcgaagaagagcagctgtgt
cagcgtgcggaacagcttggcagccacctgaaagaggtgctgaatcaggcgcgcgagtat
tgcccggcgatcgttgatattcgcgggcagggctcaatggttgccgtggagtttaacgat
ccgcagaccggcgcgccgtcaccggagtttacccgccacatccagcaaaaggcgcaggaa
aatggtctgctgctgctgagctgcggcgtctatggcaacgttatccgtttcctgtatccg
ttaactatccccgatgcgcagtttacaaaagcgctggatattctggcgcgcgtcctgaag
ggatga

DBGET integrated database retrieval system