KEGG   Pararhodospirillum photometricum: RSPPHO_00538Help
Entry
RSPPHO_00538      CDS       T01851                                 

Gene name
cbbL2
Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
rpm  Pararhodospirillum photometricum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RSPPHO_00538 (cbbL2)
Enzymes [BR:rpm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RSPPHO_00538 (cbbL2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(695830..697248)
Genome map
AA seq 472 aa AA seqDB search
MGKTYQAGVKEYRETYWDPNYTPKDSDILACFKVVPQPGVPREEAAAAVCAESSTATWTT
VWTDLLTDLDYYKGRAYAIEDVPGHDEAFYAFIAYPMGLFEEGSIVNVFTSLVGNVFGFK
AVRSLRLEDVRFPLWFVTTCDGPPHGIQVERDLLDKYGRPLLGCTIKPKLGLSAKNYGRA
VYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCQEAIEKAEAETGERKGHYLNVTAPTME
DIYQRAAFAKEIGTPIIMSDYLTIGWAAHASLSRWCRNNGMLLHVHRAMHAVIDRNPMHG
INFRVLAKLLRLLGGDHLHSGTVVGKLEGDRDATLGWIDLMRERHVKEDRSRGIFFDQDW
GHMPSVMPVASGGIHVWHMPALLAIFGDDAVFQFGGGTLGHPWGNAAGAAANRVALEACV
QARNEGRSLESEGKAILTAAARHSPELKMAMETWKEVKFEFETVDTLDVSHK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagacgtaccaggccggcgtcaaggaataccgggagacctattgggatccgaat
tacaccccaaaagacagtgacattctggcctgtttcaaggttgttccccagcctggagtg
ccccgtgaggaagcggcagccgctgtttgcgctgaatcctccaccgccacctggaccacg
gtgtggaccgaccttctgactgatctcgattattacaagggtcgggcctacgccattgaa
gacgtccctggtcatgacgaggcgttctacgcttttattgcctatccgatgggtctcttc
gaggagggctcgatcgtcaacgtgttcacctccctggtgggcaacgtctttggcttcaag
gcggtgcgctcgctacgcctggaagacgtgcggtttccgctgtggtttgtcacgacgtgc
gacggaccgccgcatggcatccaggtcgagcgcgatctcctggataagtatggccgcccc
ttgctgggctgcaccatcaagccaaaacttggtctttccgccaaaaactacggccgcgct
gtctatgagtgcctgcgcggcgggcttgatttcaccaaggatgacgagaacgtcaattct
cagccgttcatgcgttggcgtgaccgctttttgttttgccaggaggccatcgaaaaggcc
gaggcggagacaggagagcgcaagggccattatctcaacgtcaccgcgccgaccatggag
gacatctatcagcgggccgcgttcgccaaggagatcggcacgccgatcattatgagcgac
tacctgaccatcggctgggccgcgcatgccagtttgtcgcgatggtgccggaacaacggc
atgcttttgcacgttcaccgggcgatgcacgccgtgatcgatcgcaaccccatgcacggc
atcaactttcgtgttctggccaagctgctgcgcctgctggggggtgaccatctgcactcg
ggcaccgtggttggcaagctggagggcgaccgggacgccaccttgggctggatcgacctc
atgcgcgagcgtcacgtcaaggaagaccggtcgcgcggcattttcttcgaccaggactgg
gggcatatgccttccgtgatgccggtcgcctcgggagggatccacgtttggcacatgccg
gcccttctggcgatcttcggcgacgatgcggtgttccagtttggcggcggcaccttgggg
catccctgggggaatgcggcgggcgcagcggccaatcgggtggccctggaggcctgcgtc
caggcgcgaaacgagggacggtcgctggagagcgaaggcaaggccatcctgacggcggcg
gctcgccacagcccagaactgaaaatggcgatggagacctggaaggaagtaaaatttgag
tttgagaccgtagacaccctggacgtttcccacaaataa

DBGET integrated database retrieval system