KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0224Help
Entry
Rpal_0224         CDS       T00722                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Brite
Enzymes [BR:rpt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Rpal_0224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
243232..243750
Genome map
AA seq 172 aa AA seqDB search
MILRALLCTGALLGVTTAAMAADSAKATLKNAEGTEIGTATLTEGSKGVTIKLALKGLPP
GEHAFHIHAVGKCEPPFTSAGGHFNPENKKHGKMAEGGAHAGDMPNLDVPASGALSIDVV
NDAVTLAKGKPNSVFKDGGTALVIHAKADDYKSDPAGNAGDRIACGVIEEAK
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgcgagctttgttgtgcaccggcgcgctgctcggcgtcaccacggcggcgatg
gcggcggacagcgccaaggcgacgctgaagaacgccgaaggcaccgagatcggcaccgcg
acgctgaccgagggcagcaagggcgtcaccatcaagctggcgctgaagggactgccgccg
ggcgaacacgccttccacatccacgcagtcggcaaatgcgagccgccgttcacctcggca
ggcggccatttcaatccggagaacaagaagcacggcaagatggccgagggcggcgcccat
gcgggcgatatgccgaacctcgacgtgccggcctccggcgcgctgagtatcgacgtcgtc
aacgacgcggtgacgctcgccaagggcaagccgaactcggtcttcaaggacggcggcacc
gcgctggtgatccacgccaaggccgacgactacaaatcagatcccgccgggaacgccggc
gaccgcatcgcctgcggggtgatcgaggaagctaagtaa

DBGET integrated database retrieval system