KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_0980Help
Entry
Rpdx1_0980        CDS       T01381                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Rpdx1_0980
Enzymes [BR:rpx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Rpdx1_0980
Transporters [BR:rpx02000]
 Other Transporters
  Pores ion channels [TC:1]
   Rpdx1_0980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_N_2 GST_N_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ADU42607
JGI: Rpdx1_0980
UniProt: E6VBN5
LinkDB All DBs
Position
complement(1049923..1050537)
Genome map
AA seq 204 aa AA seqDB search
MKLYYSPGACSLSPHIALSEAGLPFDLVKVDLRAKKLENGDDYAAINPKGSVPALGLDDG
GVLTEGPAIVQFIADKEGSGKLAPKAGTIERYRLQEWLNYISTDLHKSFGPLFAPTLGDD
AKNFFKDRIARHLGYVDKQLAGKDYLMGSSFTVADGYLFVILSWCDRMKIDLAPYPNLAA
FKARVAARPKVQEAMQREGLMQKA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtattattcgcccggcgcctgctcgctgtcgccgcacatcgcgctcagcgag
gccggcctgccgttcgacctcgtcaaagtcgacctccgggcgaagaagctcgagaacggc
gatgactacgccgccatcaacccgaagggctcggtgccggcgctcggcctcgacgacggc
ggcgtgctcaccgagggaccggcgatcgtgcagttcatcgccgacaaggaaggctccgga
aagctcgcgcccaaggccgggacgatcgaacgctaccggctgcaggagtggctgaactac
atctcgaccgacctgcacaagagcttcggtccgctgttcgccccgacgctcggcgacgat
gccaagaatttcttcaaggaccgcatcgcccgccacctcggctatgtcgacaagcagctc
gccggcaaagactatctgatgggctcgtcgttcacggtcgccgacggctacctgttcgtg
atcctgagctggtgcgaccggatgaagatcgacctcgccccctaccccaacctcgccgcc
ttcaaggcccgcgtcgccgcacgcccgaaggtgcaagaagcgatgcagcgcgaagggctg
atgcagaaggcgtga

DBGET integrated database retrieval system