KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_1701Help
Entry
Rpdx1_1701        CDS       T01381                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Rpdx1_1701
Enzymes [BR:rpx01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Rpdx1_1701
DNA repair and recombination proteins [BR:rpx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Rpdx1_1701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ADU43318
JGI: Rpdx1_1701
UniProt: E6VKS9
LinkDB All DBs
Position
1808752..1811496
Genome map
AA seq 914 aa AA seqDB search
MASNKLSIYRKKRDFEQTAEPRGDAKVAPSKQRRFVIQKHDATRLHYDLRLEYGGVFKSW
AVTKGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVQLWDRGYWECDDPEHGF
KKGDLKFTLHGEKLHGSWVLVRMRHDRNGGKRTNWLLIKHRDDNAREGDANTVLDDDRSV
ASGRAMETIAAGKGKAPKPFMLRQAAAKVTADAVWDSSSGLAADQRAKTGAANKTTKAKP
KTPSKAKATKSAKPAARSKAAAHGKRAAMPNFVPPQLCISVERPPSGDGWGHEIKFDGYR
MQLRVEQGRAKLLTRKGLDWTAKFSAIAEDAASLPDAILDTEVVALDSHGQPDFAALQAA
LSDGDTDNLICFAFDLLYAEGEDLRRLPLSERKERLSALLKAARGRRKEGLIRYVEHFET
GGDAILQSACKLSLEGIVSKKLDAPYRSGRSGAWTKAKCRAGHEVVIGGWKTTNGKFRSL
LVGVHRGDDLAYVGIVGTGFGQGVVKRILPELKAHEADSNPFSGANAPNKTRDVHWVTPE
LVAEIEFAGFTGGGMVRQAAFKGLRADKPAAEVEAEEPQQVELAEPKPKRRAAKTAKPRK
SAGKRAAPRRADAARSEVMGVVISKPDKELWPASDISGAVTKRDLADYFAEVGDWLIPHI
KGRPCSIVRAPDGIGGELFFQRHAMPGMSNLIELAKVSGDRKPYVQIDRLEGLIAVAQIG
GVELHPWNCAQDRYDVPGRLVFDLDPAPEVGFDEVIVAAKEMKQRLEALGLATFCKTTGG
KGLHVVLPLKPDDSVDWKAAKTFAQTVCAQMAEDSPEQYLLNMSKQKRTGKIFLDYLRND
RMSTAVAVLSPRARTGATVSMPVTWSQVKAGLDPKRYTIETVPALMKRSKAWTDYNEAAA
PLKPAIKALTSGRK
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
gtggccagcaataagctcagcatctaccgcaagaaacgcgatttcgagcagaccgcggag
ccgcggggcgacgccaaggtcgcaccatcgaaacagcgacggttcgtgatccagaagcac
gatgccacccgtctgcactacgacctgcgtctggaatatggcggcgtgttcaagtcatgg
gcggtgaccaagggaccgtcgctcgatccgcacgacaagcgcctcgcggtcgaggttgag
gatcatccgctggactacggcgacttcgaaggcacgattccgaagggccagtatggcggc
ggcaccgtgcagctctgggaccgcggctattgggagtgcgacgatcccgagcacggcttc
aaaaagggcgacctgaagttcaccctgcacggcgagaagctgcatggcagttgggtgctg
gtgcggatgcggcacgaccgcaatggcggcaagcgcaccaattggctgctgatcaagcac
cgcgacgataacgcccgcgagggcgacgccaacaccgtgctcgacgacgaccgctcggtc
gcctcgggccgcgccatggagacgatcgcggcgggcaagggcaaggcaccgaagccgttc
atgctgcgccaggcggccgcgaaggtgacggcggacgcggtgtgggattccagcagcggg
cttgcggccgatcagcgggccaagaccggcgctgcgaacaagacgaccaaggccaagccg
aagacgccctccaaagcgaaagccaccaagtctgcgaaacctgcggcgcggagtaaggcg
gccgcgcatggcaagcgcgcggccatgccgaatttcgtgccgccgcagctctgcatctcg
gtggaacggccgcccagcggcgacggctggggccacgagatcaagttcgacggctaccgg
atgcagctccgcgtcgagcaggggcgagccaaactgctgactcgcaagggtctcgactgg
accgcaaagttcagcgcgatcgcggaagacgcggcgtcgctgccggacgcaattctcgac
accgaggtggtggcgctggattcgcacggccagccggatttcgccgcgctgcaggcggcg
ctgtcggacggcgacaccgacaacctgatctgctttgcgttcgatctgctgtacgcggag
ggcgaggatctgcgccggctgccgctgtcggagcgcaaggagcggctctccgctttgctg
aaggccgcacgtggccgtcgcaaggaagggctgatccgctacgtcgagcatttcgaaacc
ggcggtgacgccattctgcaatcggcctgcaagctgtcgctcgaaggcatcgtctcgaag
aagctcgatgcgccgtatcgctccggccgcagcggtgcctggaccaaggcgaagtgccgc
gccggccacgaggtggtgatcggcggttggaagaccaccaacggcaaatttcgttcgctg
ctggtcggcgttcaccgcggcgatgacctcgcctatgtgggcatcgtcggcaccgggttt
ggccagggcgtcgtcaagcgcatcctgcccgagctgaaggcgcatgaagccgatagcaat
ccgttcagtggcgccaatgcgccgaataagacgcgcgacgtccactgggtgactccggag
ctggtcgccgagatcgaatttgccggcttcaccggcggcggcatggtgcgtcaggcggcc
ttcaaggggctgcgcgccgacaagccggccgcggaggtcgaagccgaggagccgcagcag
gtcgagcttgccgaaccaaagccgaagcgccgggccgccaagacggcgaagccgcgaaag
tccgcgggcaagcgcgccgcgccccgccgcgccgacgctgcccggtccgaggtgatgggc
gtggtgatctccaagcccgacaaggagctgtggcctgcgagcgacatcagcggcgccgtg
accaagcgcgatctggccgattacttcgccgaagtgggcgactggctgatcccgcacatc
aagggacggccgtgttcgatcgtgcgcgcgcccgacggcatcggcggcgagctgttcttt
cagcggcacgccatgccgggaatgtcgaacctgatcgaactggccaaagtctccggcgac
cgcaaaccgtatgtgcagatcgaccgcctcgagggcctgatcgcggtggcgcagatcggc
ggcgtcgagttgcatccgtggaactgcgcgcaggaccgctacgacgtgccgggacggctg
gtgttcgatctcgatccggcgcccgaggtcgggttcgacgaggtgatcgtggccgccaag
gaaatgaagcagcgcctcgaagcgctggggctcgccacgttctgcaagaccaccggcggc
aagggcttgcacgtcgtgttgccgctgaagcccgacgacagtgtcgactggaaggcggcc
aagacgtttgcgcagacggtgtgtgcgcagatggccgaggacagtcccgagcagtatctg
ctcaacatgtcgaagcagaagcgcacgggaaagattttcctcgattacttgcgcaacgac
cggatgtcgaccgcggtcgcggtgctgtcgccgcgagcccgcaccggcgcaaccgtgtcg
atgccggtgacgtggtcgcaggtgaaggccggtctcgaccccaagcgctacaccatcgag
acggtgcccgcgttgatgaagcggtccaaggcgtggaccgactacaacgaggcggcagcc
ccgctgaagccggcgatcaaggcgctgacgtcgggccggaagtag

DBGET integrated database retrieval system