KEGG   Rhodococcus pyridinivorans: Y013_18110Help
Entry
Y013_18110        CDS       T02974                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
rpy  Rhodococcus pyridinivorans
Pathway
rpy00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:rpy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Y013_18110
Enzymes [BR:rpy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Y013_18110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHD22405
UniProt: V9XK94
LinkDB All DBs
Position
complement(3874352..3875800)
Genome map
AA seq 482 aa AA seqDB search
MTGLNHIDGNWVPAASGAVFERRNPADETDLIGTFPDSDAIDVRNAVDALDKAAPEWAAT
PPERRAAILEAAADHLAAHSAELVDELIREEGKTRAEASMEVTRTPMNLRFYAGEALRAT
GATFPAPGSTTIYTVREPIGIVGAITPWNFPLNIPSRKLGPALAAGNTVLFKPSEITPLM
GQRLVEALLAGGLPAGAIALIQGDGKAGAAVSGDERIAAVTFTGSTEVGRAIHRSVGPDR
RVQLEMGGKNPVVVLDDADLDAAAALIVKGAFGLSGQACTGTSRVVAVDAIHDELLEKVA
ERTLALRVGPGSGAAVDVGPLAGRGQLDKFLEYVTIGTDEGARLVCGGVRCEDDALRDGF
FVRPTVFADTAPGMRLLTDEIFGPVLAFQRAGSFDEALALANDTAFGLSASVVTRSLSAA
QRFIAGSRTGLVKVNQPTTGMAMNAPFGGYKQSSTQTFKEQAGPTLMQFYQSEKTVYLSP
DA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atcaccggactgaaccacatcgacggcaactgggtaccggccgcctccggcgcggtcttc
gaacgccgcaaccccgccgacgagaccgatctgatcggcaccttcccggactccgacgcc
atcgacgtccgcaacgccgtcgatgctctcgacaaggccgcgcccgaatgggccgccacc
ccgcccgaacgccgcgccgcgatcctcgaagcagccgccgaccacctcgccgcacactcg
gccgaactcgtcgacgaactgatccgcgaagagggcaagacccgcgccgaggcgtcgatg
gaggtgactcgcacccccatgaacctgcgcttctacgcaggtgaggcactgcgcgccacc
ggtgcgaccttcccggcaccgggctccacgaccatctacaccgtgcgcgaaccgatcggg
atcgtcggtgcgatcacgccgtggaacttccccctcaacatcccctcccgcaagctcggg
cccgcgctcgccgccggcaacacggtgctgttcaagccgtccgagatcaccccactgatg
ggacagcgactcgtcgaggccctactcgccggaggtctgccggcgggcgcgatcgcactg
atccagggcgacggcaaggccggtgcggcggtgtccggcgacgagcggatcgcagcggtg
accttcaccgggtccaccgaggtcggacgcgccatccaccgcagcgtcggccccgaccgg
cgcgtgcagctggagatgggcggcaagaaccccgtcgttgtcctggacgacgccgacctc
gacgcggcggccgcgctgatcgtcaagggcgccttcgggttgtcgggccaggcgtgcacc
ggcaccagccgggtcgtcgccgtcgacgcgatccacgacgaactgctcgagaaggtcgcc
gaacgcaccctcgcactgcgggtgggaccaggttcgggtgccgccgtcgatgtcggcccg
ctcgcgggtcgcggtcagctcgacaagttcctcgagtacgtcaccatcggcacggacgaa
ggcgcacggctcgtgtgcggcggcgtgcgatgcgaggacgacgcgctgcgagacggattc
ttcgtgcggcccacagtgttcgcagacaccgccccggggatgcgcctgctcaccgacgag
atcttcggcccggtcctggccttccagcgcgccggctccttcgacgaggccctggctctg
gcgaatgacaccgccttcgggctcagcgcctcggtcgtcacccggagtctgtccgctgca
cagcgtttcatcgccgggtcgcggaccgggctcgtgaaggtcaaccagcccacgacggga
atggccatgaacgcgccgttcggcggctacaagcagtcgagcacgcagaccttcaaggaa
caggccggccccacgctcatgcagttctaccagtccgagaagaccgtctacctgtccccc
gacgcctga

DBGET integrated database retrieval system