KEGG   Rhodospirillum rubrum F11: F11_02095Help
Entry
F11_02095         CDS       T02006                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    F11_02095
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    F11_02095
Enzymes [BR:rrf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     F11_02095
Peptidoglycan biosynthesis and degradation proteins [BR:rrf01011]
 Precursor biosynthesis
  Racemase
   F11_02095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(485980..487104)
Genome map
AA seq 374 aa AA seqDB search
MGHEDRATALLTVDLDAIADNWLALRGRLRPGASCAGVVKANAYGLGARKVVPALLAAGC
RDFVVAQIDEGLDILDLLPADARLFVLSGPPEGAEDEVLDSALIPVLNSPDQIDRWAKAC
ARAGRKAPAALHVDTGMRRLGLTPLELDALLADPRPLAAFTPVLVMTHLACADEPDHPLN
AEQRALFAAAAARFPGLRASLANTSGIFLGPEWHFDLARPGIGLYGGNPTVGTANPMRQV
VKLQGKILQVRRIDTPLSVGYGATHTAPAGSTIATVGVGYADGFPRSAGNRAMGLLAGRS
VPVVGRVSMDLLTFDVSDVPENLARPGAMIDLLGPDLSVDALADRADTVSYEILTRLGAR
YPRRYGGVREGSGQ
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggtcatgaggaccgggcgacggcccttcttaccgtcgatcttgatgccatcgccgat
aactggctggccctgcgcggccggctgcgccccggggcgtcgtgcgccggggtggtcaag
gccaatgcctatggcctgggggcgcgcaaggtcgttcccgccttgctggccgccggctgc
cgcgatttcgtcgtcgcccagatcgacgagggcctggatatcctcgatctgctgcccgcc
gacgcccgcctgttcgtgctctcgggcccgcccgagggggccgaggacgaggtgctcgac
agcgcgctgatcccggtgctcaacagtcccgatcaaatcgaccgttgggccaaggcctgc
gcgcgggccgggcgcaaggcgccagccgcccttcatgtcgataccggcatgcgccgcctg
gggctgacgccgctggaactcgacgccctgctcgccgatccccgcccgctcgccgccttc
accccagtgctggtgatgacccatctcgcctgcgccgacgagcccgatcatccgctcaac
gccgagcagcgcgccctgttcgccgccgccgccgcccgcttccccggcctgcgcgccagc
cttgccaatacctcgggcattttcctgggccccgagtggcattttgatctggcgcgcccg
ggaattggtctttatggcggaaatccgaccgtcggtacagccaaccccatgcggcaagtg
gttaaattacaaggaaaaatcctgcaagttcgccgcattgacacccccttgagcgttggc
tatggtgcaacgcatacggccccggcgggaagcacgatcgcaaccgtcggtgtcggatat
gccgacggatttccgcgttcggcgggcaaccgggccatggggcttctggccggtcgatcc
gttccggtcgttggtcgtgtgtccatggatctgctgaccttcgacgtatcggatgttccc
gaaaacttggcgagacccggtgccatgatcgaccttcttggacccgatctgagtgtggac
gccctggccgatcgcgccgatacggtgtcctacgaaattctcacgcgactaggcgcgcgc
tacccgcgccgctacggcggggtgagggaggggagcggccaatga

DBGET integrated database retrieval system