KEGG   Rickettsia rickettsii Morgan: RRM_00755Help
Entry
RRM_00755         CDS       T03662                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
rrm  Rickettsia rickettsii Morgan
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rrm00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    RRM_00755
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    RRM_00755
Enzymes [BR:rrm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     RRM_00755
Peptidoglycan biosynthesis and degradation proteins [BR:rrm01011]
 Precursor biosynthesis
  Racemase
   RRM_00755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
126156..127223
Genome map
AA seq 355 aa AA seqDB search
MSLCTVEINLSTIKNNYLLLQDVCKTSLVGAAVKANGYGLGAIQISKALIEENCRHFFVA
SSEEGVNLRNALGLDINILVLNGVFEHDALELIEYNLTPVLNNLKQIEIWQKFSNLKNRL
LPCYLHFNTGINRLGLSSDEIEQLINDRDLLKGLDLQYIISHLAISEEIDNPYNLEQLNR
FKAYLQYFPNVKASLANSGGIFLGQDYHFDLARPGAALYGLNPLTKNPVTLKAPIIHLQN
LTLDSHIGYNMTFTTKRDSVIATLPLGYADGFSRNFSNQGEVFINSRSVPIVGRVSMDLI
NIDVTDLPPSEIFLGQEAEIIGNYCTPNKIASIIGTIGYEVLTNLGSRYKRKYIG
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgtgtactgtagaaataaatctatctacaataaaaaataattaccttttatta
caagatgtttgcaaaacctcattagtcggtgctgccgttaaagctaacggttacggtctt
ggagcaatacaaatttctaaagctttaatagaagaaaattgtaggcatttttttgtggcc
tcaagtgaagaaggagtgaatttacgcaacgctttaggattagatattaatattttagtt
cttaacggcgtttttgaacatgatgctttagagctgatagaatataatttaacacctgtc
ctaaataacttaaaacaaatagaaatttggcaaaaatttagtaatttgaaaaaccgatta
ttgccttgttatttacatttcaatacggggattaatcgtcttggcttaagctctgatgag
atagagcagctcattaatgatcgtgatttgttaaaagggctagatttacaatatattata
agccatctagctatatccgaggaaatagataatccttataatctagaacaattaaacaga
tttaaagcttatttacaatatttcccaaacgtcaaagcaagccttgctaattccggcggc
atatttttaggacaggattaccattttgatttagcaagaccaggggcagccttatatggt
cttaatcccttaacaaagaatcccgtaaccttaaaagctcctataattcacttacagaat
ttgacactagatagccatatcggttataatatgacttttacaactaagcgtgatagtgtc
attgcaacgttaccgcttggttatgctgatgggtttagtcgtaattttagcaatcaaggc
gaagtatttattaacagtcgcagcgttcctatagtagggcgagtatcgatggatttaata
aatatcgatgttaccgatctaccaccatccgagatttttctagggcaggaagcggaaatt
atcggaaattattgcacgcccaataaaatagcgagtattataggtactatcgggtatgag
gtattaactaaccttggtagtagatataaaagaaagtatatcgggtag

DBGET integrated database retrieval system