KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655029Help
Entry
104655029         CDS       T03989                                 

Gene name
B3GALT1
Definition
(RefSeq) beta-1,3-galactosyltransferase 1
  KO
K07819  beta-1,3-galactosyltransferase 1 [EC:2.4.1.86]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00601  Glycosphingolipid biosynthesis - lacto and neolacto series
rro01100  Metabolic pathways
Module
rro_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:rro00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    104655029 (B3GALT1)
Enzymes [BR:rro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     104655029 (B3GALT1)
Glycosyltransferases [BR:rro01003]
 Glycan extension
  Type 1 chain
   104655029 (B3GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 104655029
NCBI-ProteinID: XP_010352706
LinkDB All DBs
Position
Un
AA seq 326 aa AA seqDB search
MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTFGNIRTRPINP
HSFEFLINEPNKCEKNVPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGK
NADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDI
FVNMDNLIYKLLKPSTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTG
YIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRV
ITVHQISPEEMHRIWNDMSSKKHLRC
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaggtctcctgtttgtatgttttgacagttgtgtgctgggccagcgctctc
tggtacttgagtataactcgtcctacttcttcttacactggctccaaaccattcagccac
ctaacagttgccaggaaaaacttcacctttggcaacataagaactcgacctattaaccca
cattcttttgaatttcttatcaacgagcccaataaatgtgagaaaaacgttccttttctt
gttatcctcatcagcaccactcacaaggaattcgatgcccgtcaggcaatcagagagaca
tggggggatgagaacaactttaaggggatcaagatagccactctcttcctcctgggcaag
aatgctgatcctgttctcaatcagatggtggagcaggagagccaaatcttccatgatatc
atcgtggaggacttcattgactcctaccataaccttaccctcaaaacattaatggggatg
agatgggtggccactttttgttcaaaagccaagtatgtcatgaaaacagacagtgacatt
tttgtgaacatggacaatcttatttataagttactgaaaccctccaccaagccacgaaga
aggtattttactggctatgtcattaatggaggaccaattcgggacgtccgcagtaagtgg
tatatgcccagggatttgtacccagacagtaactacccaccgttctgttcagggactggc
tacatcttttcagccgatgtggctgaactcatttacaagacctcactccacacaaggctg
cttcaccttgaagatgtatatgtgggactgtgtcttcgaaagctgggcatacatcctttc
cagaacagtggcttcaatcactggaaaatggcctacagtttgtgtaggtatcgccgagtt
atcacagtgcatcagatctctccagaagaaatgcacagaatctggaatgatatgtcaagc
aagaaacatctcagatgttag

DBGET integrated database retrieval system