KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662683Help
Entry
104662683         CDS       T03989                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
Enzymes [BR:rro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     104662683 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 808 aa AA seqDB search
MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDRRFRRGGGGRSFWARCCGCCSCRNVADD
DWGPEPSDSRGRGSSSGTRRPGSRGSGVNAAGDGTIREGMLVVTGVDLLSSRSDQNRQEH
HTDEYEYDELIVRRGQPFHMLLLLSRTYESSDRITLELLIGNNPEVGKGTHVIIPVGKGG
SGGWKAQVTKASGQTLNLRVHTSPNAIIGKFQFTVRTQSDAGEFQLPFDPRNEIYILFNP
WCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDACLYILDRRG
MPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVEILLSYLRTG
YSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDENMKPLEHLNH
DSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESIKNGLVYMKY
DTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAIGSNMREDITYLYKHPEG
SDAERKAVETATAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVMLTNHSSSRRT
VKLHLYLSVTFYTGVTGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHLVDQGAMLLNV
SGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLE
GSGLQRPKILNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPA
PGARGFFSDAGGDSHLGETIPMASRGGA
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgggccacgttccgacgttggccgttggggtggcaaccccttgcagccccct
accacgccttctccagagccagagccagagccagacagacgctttcgcagaggaggagga
ggccgttccttctgggctcgctgctgtggctgctgttcatgtcgaaatgtggcagatgac
gactggggacctgaaccctctgactccaggggtcgagggtccagctctgggactcgaaga
cctggctcccggggcagtggtgtcaatgcagctggagatggcaccatccgagagggcatg
ctagtagtgaccggtgtggacttgctgagctcacgctcggaccagaaccgccaagagcac
cacacagacgagtatgaatacgatgagctgatagtacgtcgcgggcagcctttccacatg
cttctccttctgtcccggacctatgaatcctctgatcgcatcacccttgagttactcatc
ggaaacaaccccgaggtgggcaagggcacgcacgtgatcatcccagtgggcaaggggggc
agtggaggctggaaagcccaggtgaccaaggccagtgggcagactctgaacctacgggtc
cacacttcccccaacgccatcatcggcaagtttcagttcacagtccgcacacagtcagac
gctggggagttccagttgccctttgaccctcgcaacgagatctacatccttttcaacccc
tggtgcccagaggacattgtgtacgtggaccatgaggattggcggcaggagtatgtgctt
aatgagtctgggagaatttactatgggaccgaagcacagattggcgagcggacgtggaac
tacggccagtttgaccatggggtgctggatgcctgcctatacatcctggaccggcggggg
atgccatatggaggccgtggagacccagtcagtgtctcccgggtcatctctgccatggtg
aactccctggatgacaatggagtcctgattgggaactggtctggtgattactcccgaggc
accaacccatcagcgtgggtgggcagcgtggagatcctgcttagctatctacgcaccggc
tattccgtcccatatggccagtgctgggtctttgctggcgtgaccactacagtgctgcgc
tgcctgggtctggccacccgtactgtcaccaacttcaactccgcccatgacacagacaca
tcccttaccatggacatctacttcgatgagaacatgaagcccctagagcacctgaaccat
gattctgtctggaacttccatgtgtggaacgactgctggatgaagaggccagatcttccc
tcgggcttcgatgggtggcaggtggtggatgccacaccccaggagactagcagtggcatc
ttctgctgtggcccctgctctgtggagtccatcaagaatggcctggtctacatgaagtat
gacacgcctttcatttttgctgaggtgaatagtgacaaggtgtactggcagcggcaggac
gatggcagcttcaagattgtgtatgtggaggagaaggccatcggcacactcattgtcaca
aaggccatcggctccaacatgcgggaggacatcacctacctctataagcacccagaaggt
tcagatgcggagcggaaggcagtagagacagcaacagcccacggcagcaaacccaatgtg
tacgccaaccggggctcagcggaggatgtggccatgcaggtggaggcacaggacgcggtg
atggggcaggatctgatggtctcggtcatgctgaccaatcacagcagcagccgccgcaca
gtgaaactgcacctctacctctcagtcaccttctataccggtgtcactgggaccatcttc
aaggaaaccaagaaggaagtggagctggcaccaggggcctcggaccgtgtgaccatgcca
gtggcctacaaggaataccggccccacctcgtggaccaaggggccatgctgctgaacgtc
tcaggccacgtcaaggagagcgggcaggtgctggccaagcagcacaccttccgtctgcgt
acgccagacctctccctcacgttactgggagcagcagtggttggccaggagtgtgaagta
cagattgtcttcaagaacccccttcccgtcaccctcaccaatgtcgtcttccggctcgag
ggctctgggttacagaggcccaagatccttaacgttggggacatcggaggcaatgaaaca
gtgacactgcgccagacgtttgtgcctgtgcgaccaggcccccgccagctcattgccagc
ttggacagcccgcagctctcccaggtgcatggtgtcatccaggtggatgtggccccagcc
cctggggccaggggcttcttctcagatgctggaggtgacagtcacttgggagagaccatc
cctatggcatctcgaggtggagcttag

DBGET integrated database retrieval system