KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674634Help
Entry
104674634         CDS       T03989                                 

Gene name
TGM3
Definition
(RefSeq) transglutaminase 3
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
Enzymes [BR:rro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     104674634 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 104674634
NCBI-ProteinID: XP_010377319
UniProt: A0A2K6RXH7
LinkDB All DBs
Position
Un
AA seq 693 aa AA seqDB search
MAALGLQSINWQTALNRQAHHTHKFSSQELILRRGQNFQVLMLMNKGLGSSERLEFIVST
GPYPSESAMTKAVFPLSNGSSGGWSAVLQASNGNTLTISISSPASAPIGRYTMALQISSQ
GGISSVKLGTFILLFNPWLNADSVFMGNHAEREEYVQEDAGIIYVGSTNRISMIGWNFGQ
FEEDILSICLSILDRSLNFRRDPATDVARRNDPKYVGRVLSAMINSNDDNGVLAGNWSGT
YTGGRDPRNWNGSVEILKDWKKSGFSPVRYGQCWVFAGTLNTALRSLGIPSRVITNFSSA
HDTDRNLSVDVYYDPMGNPLDRGSDSVWNFHVWNEGWFVRSDLGPSYGGWQVLDATPQER
SQGVFQCGPASVIGIREGDVNLSFDMPFIFAEVNADRITWLYDNTTGKQTKNSVDTRTIG
RYISTKAVGSNARMDVTDKYKYPEGSDQERQVFQKALGKLKPSASFGATSSMGLEAEERE
SSISGKFKVTGMLAVGKEVNLVLLLKNLSSDTKTVTVNMTAWTIVYNGTLVHEVWKDSAT
MSLDPEEEAEHPVKISYAQYEKYLKSDNMIRITAVCKVPDEPGVVVERDIILDNPTLTLE
VLDEARVQKPVNVQMLFSNPLDEPVRDCVLMVEGSGLLLGNLKIDVPTLRPKERSRVRFE
ILPTRSGTKQLLADFSCNKFHAIKAMLSVDVVE
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggctgctctaggactccagagtatcaactggcagacggccctcaaccgacaagcgcat
cacacacacaagttctccagccaggagctcatcttgcggagaggccaaaacttccaggtc
ttaatgctcatgaacaaaggccttggctctagcgaaagactggaattcattgtctccaca
gggccttacccctccgagtcggccatgacgaaggctgtgtttccactctccaatggcagt
agcggtggctggagtgcggtgcttcaggccagcaatggcaatactctgactattagcatt
tccagtcctgccagcgcacccataggacggtacacaatggccctccagatctcctcccag
ggcggcatctcctctgtgaaacttgggacgttcatactgctttttaacccctggctgaac
gcggatagcgtctttatgggtaaccatgctgagagagaagagtatgttcaggaagatgcc
ggcatcatctatgtgggaagcacaaatcgaattagcatgattggctggaactttggacag
tttgaagaagacattctgagcatctgcctctcaatcttggataggagtctgaacttccgc
cgtgaccctgctactgatgtggcccgcagaaatgaccccaaatacgttggccgggtgctg
agtgccatgatcaatagcaatgatgacaatggtgtgcttgctgggaattggagtggcact
tacacgggtggtcgtgacccaaggaactggaacggcagcgtggagatcctcaaggactgg
aaaaaatctggcttcagcccagtccgatatggccagtgctgggtctttgctgggaccctc
aacacagcgctgcggtctttggggattccttcccgggtgatcaccaacttcagctccgct
catgatacagaccgaaatctcagtgtggatgtgtactacgaccccatgggaaaccccctg
gacaggggtagtgatagtgtatggaatttccatgtctggaatgaaggctggtttgtgagg
tctgacctgggtccctcgtacggtggatggcaggtgttggatgctaccccgcaggaaaga
agccaaggggtgttccagtgtggccccgcttcggtcattggcattcgagagggtgatgtg
aacctgagcttcgacatgccctttatcttcgcggaggtgaatgccgaccgcatcacctgg
ctgtatgataacaccaccggcaaacagacaaagaattccgtggacactcgcaccattggc
aggtacatcagcaccaaggcagtgggaagtaacgctcgcatggacgtcacggacaagtac
aagtatccagaaggctctgaccaggaaagacaagtgttccaaaaggctttggggaaactt
aaacccagtgcgtcatttggcgcaacgtcttcaatgggtttggaagcagaggaacgggag
tccagcatcagcgggaagttcaaggtcactggcatgctggcagtgggcaaagaagtcaac
ctggtcctactgctcaaaaacctgagcagcgatacgaagacagtgacagtgaacatgaca
gcctggaccattgtctacaacggcacacttgtacatgaggtgtggaaggactctgccaca
atgtccctggaccctgaggaagaggcagagcatcctgtaaagatctcgtacgctcagtat
gaaaagtacctgaagtccgacaacatgatccggatcacagccgtgtgcaaggtcccagat
gaacctggggtggtggtggagcgggacatcatcctggacaaccccaccttgaccctggag
gtgctggatgaggctcgtgtgcagaagcctgtgaacgtgcagatgctcttctccaatcca
ctggatgagccagtgagggactgtgtgctgatggtggagggaagcggcctgctgttgggt
aacctgaagattgatgtgccgaccctacgtcccaaggagcggtcccgggtccgttttgag
atcctgcccacccggagtggcaccaagcaactgctcgccgacttctcctgcaacaagttc
catgcaatcaaggccatgctgtctgtcgacgtagtcgaatga

DBGET integrated database retrieval system