KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104678377Help
Entry
104678377         CDS       T03989                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04064  NF-kappa B signaling pathway
rro04210  Apoptosis
rro04380  Osteoclast differentiation
rro04625  C-type lectin receptor signaling pathway
rro04660  T cell receptor signaling pathway
rro04668  TNF signaling pathway
rro04672  Intestinal immune network for IgA production
rro05166  HTLV-I infection
rro05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rro00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    104678377 (MAP3K14)
   04064 NF-kappa B signaling pathway
    104678377 (MAP3K14)
   04668 TNF signaling pathway
    104678377 (MAP3K14)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    104678377 (MAP3K14)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    104678377 (MAP3K14)
   04660 T cell receptor signaling pathway
    104678377 (MAP3K14)
   04672 Intestinal immune network for IgA production
    104678377 (MAP3K14)
  Development
   04380 Osteoclast differentiation
    104678377 (MAP3K14)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    104678377 (MAP3K14)
   05169 Epstein-Barr virus infection
    104678377 (MAP3K14)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     104678377 (MAP3K14)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: STE group
  Other
   104678377 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 104678377
NCBI-ProteinID: XP_010381931
UniProt: A0A2K6PY40
LinkDB All DBs
Position
Un
AA seq 947 aa AA seqDB search
MAVMEMACPGAPGSAVGQQKELPKAKEKTPPLGKKQSSVYKLEAVEKSPVFCGKWEILND
VITKGTAKEGSEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
VAHATEGKMARVCWKGKRRSKARKKRKKKSSKSLAHAGVALAKPLPRTPEQESCTIPVQE
DESPLGTPYVRNTPQFTKPLKEPGLGQLCFKQLGEGLRPALPRSELHKLISPLQCLNHVW
KLHHPQDGGPLPLPTHPFPYSRLPHPFPFHPLQPWKPHPLESFLGKLACVDSQQPLPHPH
LSKLACVDSPKPLPGPHLEPSCPSRGAHEKFSVEEYLVHALQGSVSSGQAHSLTSLAKTW
AVGGSRPREPSPKTEDSEGVLLTEKLKPVDYEYREEVHWATHQPRLGRGSFGEVHRMEDK
QTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQL
VKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVC
LQPDGLGKSLLTGDYIPGTETHMAPEVVLGRRCDAKVDVWSSCCMMLHMLNGCHPWTQFF
RGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLKKEPVHRASAAELAGKVNRALQQVGG
LKSPWRGEYKEPRHPPPNQANYHQTLHAQPRELSPRAPAPRPVEETTGRAPKLQPPLPPE
PPEPNKSPPLTLSKEESGMWEPLPLSSLEPAPARNPSSPERKATFPEQELQQLEIELFLN
SLSQPFSLEEQEQILSCLSIDSLSLSDDSEKNPSKASQSSRDTLSSGVHSWSSQAEARSS
SWNMVLARGRPTDTPSYFNGVKVQIQSLNGEHLHIREFHRVKVGDIATGISSQIPAAAFS
LVTKDGQPVRYDMEVPDSGIDLQCTLAPDGSFAWSWRVKHGQLENRP
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatggaaatggcctgcccaggcgcccctggctcagcagtggggcagcagaag
gaactccccaaagccaaggagaagacgccgccactggggaagaaacagagctccgtctac
aagcttgaggccgtggagaagagccctgtgttctgcggaaagtgggagatcctgaacgac
gtgattaccaagggcacagccaaggaaggctctgaggcagggccagctgccatctctatc
atcgcccaggctgagtgtgagaatagccaggagttcagccccaccttttcagaacgcatt
ttcatcgctggttccaaacagtacagccagtctgagagtcttgatcagatccccaacaat
gtggcccatgctaccgagggcaaaatggcccgtgtgtgttggaagggaaagcgtcgtagc
aaagcccggaagaaacggaagaagaagagctcaaagtccctggctcatgcaggagtggcc
ttggccaaacccctccccaggacccctgagcaggagagctgcaccatcccagtgcaggag
gatgagtctccactcggcaccccatatgtgagaaacaccccacagttcaccaagcctctg
aaggaaccaggccttggtcaactctgttttaagcagcttggcgagggcctgcgaccagct
ctgcctcgatcggaactccacaaactgatcagccccttgcaatgtctgaaccacgtgtgg
aaactgcaccacccccaggatggaggccccctgcccctgcccacgcaccccttcccctat
agcagactgcctcatcccttcccattccaccctctccagccctggaaacctcacccccta
gagtccttcctgggcaaactggcctgtgtagacagccagcaacccttgcctcacccacac
ctgagcaaactggcctgtgtagacagtccaaagcccctgcctggcccacacctggagccc
agctgcccgtctcgtggtgcccatgagaagttttctgtggaggaatacctggtgcatgct
ctgcaaggcagcgtgagctcaggccaggcccacagcctgaccagcctggccaagacctgg
gcagtagggggctccagaccccgggagcccagccccaaaactgaggacagcgagggcgtc
ctgctcactgagaaactcaagccagtggattatgagtaccgagaagaagtgcactgggcc
acacaccagccccgcctgggcagaggctccttcggagaggtgcacaggatggaggacaag
cagactggcttccagtgcgctgtcaaaaaggtgcggctggaagtatttcgggcggaggaa
ctgatggcatgtgcaggattgacctcacccagaattgtccctttgtatggagctgtgagg
gaagggccttgggtcaacatcttcatggagctgctggaaggtggctccctgggccagctg
gtcaaggagcagggctgtctcccagaggaccgggccctctactacctgggccaggccctg
gaggggctggaatacctccactcacgaaggattctgcatggggacgtcaaagctgacaac
gtgctcctgtccagcgatgggagccatgcagccctctgcgactttggccatgctgtgtgt
cttcaacctgatggcctggggaagtccttgctcacaggggactacatccctggcacagag
acccacatggctccggaggtggtgttgggcaggcgctgcgacgccaaggtggacgtctgg
agcagctgctgcatgatgctgcacatgctcaacggctgccacccctggactcagttcttc
cgagggccgctctgcctcaagattgccagcgagcctccgcctgtgagggagatcccaccc
tcctgtgcccctctcacagcccaggccatccaggagggactgaagaaagagcctgtccac
cgtgcgtctgcagcggagctggcagggaaggtgaaccgggcactacagcaagtgggaggt
ctgaagagcccttggaggggagaatataaagaaccaagacatccaccaccaaatcaagcc
aattatcaccagaccctccatgcccagccgagggagctttcgccaagggccccagcgcct
cggccagttgaggagacaacaggcagagcccctaagctccagcctcctctcccaccagag
cccccagagccaaacaagtctcctcccttgactttgagcaaggaggagtctggaatgtgg
gaacccttacctctgtcttccctggagccagcgcctgccagaaaccccagctcaccagag
cggaaagcaaccttcccagagcaggaactgcagcagctggaaatagaattattcctgaac
agcctgtcccagccattttctctggaggagcaggaacaaattctctcgtgcctcagcatc
gacagcctctccctgtcggatgacagcgagaagaacccatcaaaggcctctcaaagctcg
cgcgacaccctgagctcaggcgtacactcctggagcagccaggctgaggctcgaagctcc
agctggaacatggtgctggcccgggggcggcccaccgacaccccaagctatttcaatggt
gtgaaagtccaaatacagtctctcaatggtgaacacctgcacatccgggagttccaccgg
gtcaaagtgggagacatcgccactggcatcagcagccagatcccagccgcagccttcagc
ttggtgaccaaagatgggcagcctgttcgctatgacatggaggtgccagactcgggcatt
gacctgcagtgcacgctggcccctgatggcagcttcgcctggagctggagggtcaagcat
ggccagctggagaacaggccctaa

DBGET integrated database retrieval system