KEGG   Roseiflexus sp. RS-1: RoseRS_2372Help
Entry
RoseRS_2372       CDS       T00542                                 

Definition
(GenBank) glycosyl transferase, group 1
Organism
rrs  Roseiflexus sp. RS-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2935011..2936162
Genome map
AA seq 383 aa AA seqDB search
MTTLSTRPLRVLHVRPRLGVGGATEYLIRLAESQAEAGYFVAIASGGGEWSRRVAAFAHH
YDQTPLTPYIGPGKRAPNLPALLAAGLKLAHIIRVGRIDIVNTHHRFAALAAKLASRLTN
VPVVTTLQEVPWKNRRLTRFALGVQAITMSAMMKRFVMETCGVPSDRVTVIPIGINIPSS
LSDERRRHLLEDLGLDGSAPIIASVGRLVARKGHIYLLRALPAVVRAHPTLQAVLVGDGE
ERASLEQAARDLGVARHVTFAGARSDAVDIMALADFTVLPSLEEEFGIVITESFACAKPV
VATNVGGIPEHVRPMENGILVPPGDSRALAEQIILLLDHPTLVQQLGQQGRRAVEQHYTR
QRFFERTEAVYHAALQRRSEVVR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgctatcgaccagaccactgcgtgttttgcacgtgcgtccgcgcctgggggtt
ggaggcgcaaccgagtatctcatccggctggctgagagccaggcggaagccgggtatttc
gtggcaatcgcttctggcggcggtgaatggagcaggcgcgtggcggcgtttgcgcaccat
tatgatcagacgccgctcactccgtatatcggtcctggcaagcgggcgccgaatctgccg
gcgctgctggcagccgggttgaaactggcgcacatcatccgtgtcgggcgcatcgatatt
gtgaacacccaccaccgctttgctgcgctcgccgcgaaactggcgtcacgcctgaccaat
gtgccggttgtgacgacacttcaggaagtgccgtggaagaatcgccgtctgacgcgcttc
gcccttggcgttcaggcgattacgatgagcgcaatgatgaaacgtttcgttatggagacc
tgtggcgtgccgtctgaccgcgtcaccgtgatcccgattggcattaacatcccgtcatct
ctctcggacgaacgccggcgccatctgctggaagaccttggtctcgacggatcggcgccg
atcatcgccagtgtcgggcgcctggtcgcgcgcaaagggcatatctatctgctgcgggcg
cttccggctgtggtgcgagcgcacccaacccttcaggctgtgctggttggcgacggcgaa
gaacgcgcctcgctcgaacaggcggcacgtgatctgggtgtggcgcgtcatgtcacgttc
gcaggagcgcgcagcgacgcagttgatattatggcgctcgccgacttcacggtactcccc
tcgctggaggaagaattcggcattgttatcaccgaatcgttcgcctgtgcgaagccggtg
gtagcaacaaacgttggcggcattcccgaacatgtgcgcccgatggagaatggcatcctt
gtaccgccgggggacagtcgcgcgctggcggagcagatcatccttctgctcgatcatccc
acactggtgcagcagttgggtcagcaggggcggcgcgccgtcgagcagcactatacgcga
cagcgcttcttcgaacgcaccgaagcggtctaccacgctgcgctgcaacgccggtcggag
gtggtgcgatga

DBGET integrated database retrieval system