KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A0409Help
Entry
Rru_A0409         CDS       T00310                                 

Definition
(RefSeq) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Rru_A0409
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Rru_A0409
Enzymes [BR:rru01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Rru_A0409
Peptidoglycan biosynthesis and degradation proteins [BR:rru01011]
 Precursor biosynthesis
  Racemase
   Rru_A0409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(485980..487104)
Genome map
AA seq 374 aa AA seqDB search
MGHEDRATALLTVDLDAIADNWLALRGRLRPGASCAGVVKANAYGLGARKVVPALLAAGC
RDFVVAQIDEGLDILDLLPADARLFVLSGPPEGAEDEVLDSALIPVLNSPDQIDRWAKAC
ARAGRKAPAALHVDTGMRRLGLTPLELDALLADPRPLAAFTPVLVMTHLACADEPDHPLN
AEQRALFAAAAARFPGLRASLANTSGIFLGPEWHFDLARPGIGLYGGNPTVGTANPMRQV
VKLQGKILQVRRIDTPLSVGYGATHTAPAGSTIATVGVGYADGFPRSAGNRAMGLLAGRS
VPVVGRVSMDLLTFDVSDVPENLARPGAMIDLLGPDLSVDALADRADTVSYEILTRLGAR
YPRRYGGVREGSGQ
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggtcatgaggaccgggcgacggcccttcttaccgtcgatcttgatgccatcgccgat
aactggctggccctgcgcggccggctgcgccccggggcgtcgtgcgccggggtggtcaag
gccaatgcctatggcctgggggcgcgcaaggtcgttcccgccttgctggccgccggctgc
cgcgatttcgtcgtcgcccagatcgacgagggcctggatatcctcgatctgctgcccgcc
gacgcccgcctgttcgtgctctcgggcccgcccgagggggccgaggacgaggtgctcgac
agcgcgctgatcccggtgctcaacagtcccgatcaaatcgaccgttgggccaaggcctgc
gcgcgggccgggcgcaaggcgccagccgcccttcatgtcgataccggcatgcgccgcctg
gggctgacgccgctggaactcgacgccctgctcgccgatccccgcccgctcgccgccttc
accccagtgctggtgatgacccatctcgcctgcgccgacgagcccgatcatccgctcaac
gccgagcagcgcgccctgttcgccgccgccgccgcccgcttccccggcctgcgcgccagc
cttgccaatacctcgggcattttcctgggccccgagtggcattttgatctggcgcgcccg
ggaattggtctttatggcggaaatccgaccgtcggtacagccaaccccatgcggcaagtg
gttaaattacaaggaaaaatcctgcaagttcgccgcattgacacccccttgagcgttggc
tatggtgcaacgcatacggccccggcgggaagcacgatcgcaaccgtcggtgtcggatat
gccgacggatttccgcgttcggcgggcaaccgggccatggggcttctggccggtcgatcc
gttccggtcgttggtcgtgtgtccatggatctgctgaccttcgacgtatcggatgttccc
gaaaacttggcgagacccggtgccatgatcgaccttcttggacccgatctgagtgtggac
gccctggccgatcgcgccgatacggtgtcctacgaaattctcacgcgactaggcgcgcgc
tacccgcgccgctacggcggggtgagggaggggagcggccaatga

DBGET integrated database retrieval system