KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1213Help
Entry
Rru_A1213         CDS       T00310                                 

Gene name
sucA
Definition
(RefSeq) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rru_A1213 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    Rru_A1213 (sucA)
   00380 Tryptophan metabolism
    Rru_A1213 (sucA)
Enzymes [BR:rru01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Rru_A1213 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1431270..1434233
Genome map
AA seq 987 aa AA seqDB search
MGDDVETSFLTGANAVYIAEVYSRYLADPSSVDPSWVAFFGELRDGAEELSGDLKGPSWT
SRGNAVIGTADPDAPAAAKAGKNGKAAAAPVPAAPAAAGLSTAEVRAHTLDSVRALMMIR
AYRVRGHLVADLDPLGLNKNNEHPELDYRSYGFTDADLEREIFIDNVLGMESATLRKIVE
VVRETYCGTIGVEFMHIQDPEQKSWIQRRIEGERNHTRFTPEGKRAILERLTEAEGFEKF
LQVKYTGTKRFGLEGGETVIPAIEQILKRGSQLGLTDINLGMAHRGRLNLLTSLLHKPYR
AIFSEFQGNSANPDDVQGSGDVKYHLGTSADREFDGAVVHLSLQANPSHLEAADPVVLGK
VRAKQTQLGDTDRKAVMALLIHGDAAFAGQGLVAECFGLSQLKGYRTGGTIHIVINNQIG
FTTSPQYSRSGQYCTDIAKMVQAPIFHVNGDDPEAVVHTARIVTEFRQEFGVDVVLDMVC
YRRHGHNESDEPAFTQPLMYDSIAHRQTTRTLYAQKLVSEGLISQAEADGLADAFTARLE
TEFQAATSYKPNRADWLAGKWEGLEALNGEEEFRQDRTEVPAEVLRRVGTALSTPPENFD
TNRKILRQMKAKAEMLETGQGIDWATAEALAFGTLLLEGTRVRLSGQDSGRGTFSHRHSV
LIDQTNENRHIPLDHLDPAQARFEVIDSPLSEFSVLGFEYGYSLAEPKALVLWEAQFGDF
ANGAQVIFDQFISSAESKWLRMSGLVCLLPHGYEGQGPEHSSARPERYLQLCAEDNMQVV
NITSPANYFHALRRQVHRNFRKPLIVMAPKSLLRHKLAVSPLSDFTDHGFRRVLPETKTL
VEDDKITRVVLCSGKVYYDLYQAREDQGIDDVAIVRIEQLYPWPKDTLMKVLKRYPNADV
VWCQEEPANMGYWTFVDRRIEFFLQELEHRPGRASYAGRPAAASPATGSNRGHGREQALL
VEQALTWKRDVLPQPFRRATKLSIIGQ
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgacgtggaaacgtcttttctgaccggagccaacgcggtctatatcgccgaa
gtctacagccgctaccttgccgatccgtcctccgtcgatccaagctgggtcgcctttttc
ggcgaattgcgcgatggcgccgaggaactgagcggtgatctcaagggaccttcgtggacc
tcgcgggggaacgcggtgatcggcaccgccgatcccgacgcccccgccgccgccaaggcc
gggaaaaacggcaaggccgccgccgctccggtccccgccgctccggccgccgccggtctc
tccaccgccgaagtccgcgcccacaccctggattccgtgcgcgccctgatgatgatccgc
gcctatcgggtgcgcggccatctggtcgccgaccttgatccgcttggcttgaacaagaac
aacgagcatcccgagctcgactaccgcagctacggcttcaccgatgccgatctcgagcgc
gagatcttcatcgataacgtgctgggcatggaaagcgccaccctgcgcaagatcgtcgag
gtcgtccgcgaaacctattgcggcaccatcggcgtcgagttcatgcatattcaagatccc
gagcaaaaaagctggatccaacgccgcatcgagggcgagcgcaaccacacccgcttcact
cccgagggcaagagggccatcctggaacggctgaccgaggccgagggcttcgagaagttc
ctccaggtcaaatatacgggcaccaagcgcttcggcctggaaggcggcgagacggtcatt
ccggcgatcgagcagatcctcaagcgcggcagccagcttggcctgaccgacatcaatctg
ggcatggcccatcgcggccggctcaatctgctgacctcgctgctgcataagccctatcgg
gcgatcttcagcgagttccagggcaatagcgccaatcccgatgacgttcagggctcgggt
gacgtgaagtaccatctgggcacctcggccgatcgtgaattcgatggcgcggtcgtccat
ctgtcgctgcaggccaatccatcccacctggaagccgccgacccggtggtgctgggcaag
gtgcgggccaagcagacccagcttggcgatacggatcgcaaggcggtgatggcgctgctg
atccacggcgacgccgccttcgccggccaggggctggtcgccgaatgtttcggcctgtcc
cagctcaagggctatcgcaccggcggcaccattcacatcgtcatcaacaaccagatcggc
ttcaccaccagcccgcagtacagccgttcgggccagtattgtaccgatatcgccaagatg
gttcaggcgccgatcttccacgtcaatggcgacgaccccgaggcggtggtgcatacggcg
cgcatcgtcaccgaattccgccaggagttcggcgtcgatgtcgtgctcgacatggtgtgt
tatcgccgccatggccataacgaaagcgacgagccggccttcacccagcccttgatgtat
gactcgatcgcccatcgccagaccacccgcacgctttatgcgcaaaagctggtgagcgag
gggctgatctcgcaggccgaggccgatggtctggccgacgccttcaccgcccgcctggaa
accgagttccaggccgccaccagctataagcccaatcgcgccgattggctggcgggcaaa
tgggaagggctggaggcgctgaacggcgaagaggaattccgccaggaccggaccgaggtg
ccggccgaggttctgcgccgggtcggcacggcgctgtcgacgccgccggaaaacttcgac
accaaccgcaagatcctgcgccagatgaaggccaaggccgagatgctggaaaccggccag
ggcatcgactgggcgaccgccgaggccctggctttcggcaccttgctgctggaaggcacg
cgggtgcggttgtcgggccaggattcggggcgcggcaccttctcgcaccgccattcggtg
ctgatcgaccagaccaacgagaaccgccacatcccgcttgaccaccttgatcccgcccag
gcgcggttcgaggtgatcgacagcccgctgtcggaattctcggtgttggggttcgaatac
ggctattcgctggccgagcccaaggccctggtgctgtgggaggcccagttcggcgatttc
gccaatggcgcccaggtgatcttcgaccagttcatcagctcggccgaaagcaagtggctg
cgcatgtcggggctggtctgcctgctgccccatggctatgagggccagggccccgagcat
tcctcggcccggcccgagcgctatctgcagctctgcgccgaagacaacatgcaggtggtc
aacatcacctcgccggccaattatttccacgccctgcgccggcaggtccaccgcaacttc
cgcaagccgctgatcgtcatggcgcccaaatcgctgctgcgtcataagctggcggtcagc
ccgctgtcggatttcaccgatcacggcttccgccgggtgctgcccgagaccaagaccctg
gtcgaggacgacaagatcacccgggtggtgctgtgttcgggcaaggtctattacgacctg
tatcaggcccgcgaggaccagggcatcgacgatgtcgccatcgtccgcatcgagcagttg
tatccctggcccaaggacaccttgatgaaggtgctcaagcgctatcccaacgccgatgtg
gtgtggtgccaggaagagccggccaatatgggctattggaccttcgtcgaccgccgcatc
gagttcttcctgcaggaactcgagcatcgccccggccgggccagctatgccggccgtccg
gccgccgcctcgccggccaccgggtccaatcgcggccatgggcgcgagcaggccttgctg
gttgaacaggccctgacctggaagcgcgatgtcctgccccagccgttccgccgcgccacc
aagctcagcatcatcgggcagtga

DBGET integrated database retrieval system