KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1605Help
Entry
Rru_A1605         CDS       T00310                                 

Definition
(RefSeq) alpha amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00500  Starch and sucrose metabolism
rru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rru00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rru_A1605
Enzymes [BR:rru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Rru_A1605
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Rru_A1605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459
Motif
Other DBs
NCBI-GeneID: 3835022
NCBI-ProteinID: YP_426692
UniProt: Q2RTZ0
LinkDB All DBs
Position
1893256..1896558
Genome map
AA seq 1100 aa AA seqDB search
MSDFLWYKDAIVYQLHVKAFFDSNGDGFGDFKGLTEKLDYLSDLGVTAVWILPFYPSPLR
DDGYDIADYKAIHRAYGTMGDFRRFVREAHERGLKVITELVINHTSDQHAWFQRAREAKP
GSKARDMYVWSDTDQRYLDTRIIFTDTETSNWAWDPLAKAYYWHRFFAHQPDLNWDNPRI
FEEITRVMKFWLDCGVDGMRLDAIPYLVERDGTNNENLPETHVVLKRLRAWLDAHYEDRM
FLAEANQWPEDVREYFGEAGDECHMAFHFPVMPRIYMAVAQEDRHPITDIMRQTPEIPAA
CQWAIFLRNHDELTLEMVTDRERDYMNTFYANDSRARINVGIRRRLAPLLDNDRRKIELL
NSLLMSMPGTPIIYYGDEIGMGDNIFLGDRDGVRTPMQWSPDRNGGFSRADPASLYLPTI
MDAVYGFFAVNVEAQSRSPSSLLNWMRRLIAVRKRHPSFGRGTLRFLYPGNRKILAYLRE
FEGEVILCVANLSRAPQPAELGLAEFSGRVPVEMLGNSVFPPIGELHYFITLPAYGFYWF
RLSKGEGPSWHEPPVEPLPDLSTLVLPRIWDSLGSDGPLRQIQGDILPAFLPKQRWFSGK
EHSLRGVEMTDHAVISAPGAASGWMLALWRADYKDGAPGQTFQLPLDIAWESREDDPLSR
LLPFTLARVRRVNRVGALYDAMAGPAFPLALVQAMAEGANVTTAKGGGLRFTRTQAFPAG
PLPGPEAVARLGREQSNTSIKLGEDMVLKLYRRVEAGIHPEIEIGRFLTDVAGFANAPPL
LGALEHIDAKGAISALAVLQGFVRNQGDGWDYMLAYLDRFLDDRAQAPAEVGEGGGPAGS
PHGIIHAQADILGQRVAELHHAFATPTEDPAFSAEAVGPEDLASWREQVRTQAAQARQAL
DTALPGLSAEVAGLVTRLLDCWERIDARVDAPISLAEGLVKTRIHGDLHLGQVVVVRDDF
HILDFEGEPVKGLSERRDKHCPLKDVAGMLRSFDYAAWSAALSFRQTHAEVRIDVLPALG
VWQEEIREAFLAGYDRAIAGCPSVPALEEGRRDLLSLFMLEKALYEVSYEAANRPDWLRI
PIGGVLRLLGEGPSDEIKPR
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacttcctatggtacaaggacgccatcgtctatcagcttcatgtaaaagccttt
tttgattcgaacggtgacgggttcggcgatttcaaggggctgaccgaaaagctggattac
ctctccgatcttggggtgacggcggtgtggatcttgccgttctatccctcgccgctgcgc
gatgacggctatgacatcgccgattacaaggccatccaccgcgcctatggcaccatgggc
gatttccgccgcttcgtgcgcgaggcccatgagcgcgggttgaaggtcatcaccgaactg
gtgatcaatcacaccagcgatcagcacgcctggttccagcgcgcccgcgaagccaagccc
ggcagcaaggcccgcgacatgtacgtgtggtccgacaccgaccagcgctatttggatacg
cgcatcattttcaccgataccgaaacctcgaactgggcctgggatccgctggccaaggcc
tattactggcaccgcttcttcgcccatcagcccgatctcaactgggacaatccgcgaatt
ttcgaggagatcacccgggtgatgaagttctggcttgattgcggcgtcgatggcatgcgc
ctggacgccattccttatttggtcgaacgcgacggcacgaataacgaaaacctgcccgaa
acccatgtcgtcctcaagcggctgcgcgcttggcttgatgcccattatgaagaccggatg
ttcctggccgaggccaatcaatggcccgaggacgtgcgcgagtatttcggcgaagccggc
gacgaatgccacatggccttccactttccggtgatgccgcgcatctatatggccgtggcc
caggaagaccgccatccgatcaccgatatcatgcgccagaccccggagatcccagcggct
tgccaatgggcgatcttcctgcgcaatcacgatgaactgacgctcgaaatggtcaccgac
cgcgagcgcgactatatgaacaccttctatgccaatgattcgcgggcccgaatcaacgtc
ggcatccgtcggcgcctggcgcctttgcttgataacgatcgccgcaagatcgaattgctc
aacagccttttgatgtcgatgccgggtacgccgatcatctattacggcgacgagatcggc
atgggcgacaatattttcctgggcgatcgcgatggcgtgcgcacgcccatgcaatggtcg
cccgaccgcaacggcggcttttcgcgggccgatcccgcctcgctttatctgccgacgatc
atggatgcggtctatggcttcttcgccgtcaatgtcgaggcccagtcgcgctcgccatcc
tcgctgctcaactggatgcgccggctgatcgccgtgcgcaagcgccacccctccttcggg
cgcggcaccttgcgctttctctatcccggcaaccgcaagatcctggcttacttgcgggaa
ttcgagggcgaggtgatcttgtgcgtggccaatctgtcgcgtgccccgcagccggccgaa
ttggggctggccgagttttccgggcgggttccggtcgagatgctgggcaacagcgtcttt
ccgccgatcggcgagttgcactatttcatcaccctgccggcctatggcttctattggttc
cgcctgtcgaagggcgaggggccgagctggcatgaaccgccggtcgagcccttgcccgat
ctttcgaccctggttcttccccgtatctgggacagcctgggcagcgatgggcccttgcgc
cagatccagggggatatcctgccggccttcctgcccaagcaacgctggttctctggcaag
gagcattccctgcgcggcgtcgagatgaccgaccacgcggtgatttcggcccccggcgcc
gcttcgggctggatgctcgccctgtggcgcgccgattacaaggatggcgccccggggcaa
accttccaattgccccttgatatcgcctgggaaagtcgcgaggacgatcccttgtcccgg
ctgctgccctttaccttggcccgggtgcggcgggtcaaccgcgttggcgccctctatgac
gccatggccggcccggctttcccgctcgccttggtgcaggcgatggccgaaggcgcgaac
gtgacgacggccaagggcggcggtttgcgcttcacccggacccaggccttccccgccggc
ccgcttcccggccccgaagcggtggcccgcctggggcgtgagcaatccaacacctcgatc
aaacttggcgaggatatggttctcaagctctatcgccgggtcgaggccgggattcatcca
gaaatcgaaatcggccgcttcctgaccgatgtcgccggcttcgccaacgccccgccgctg
cttggcgcgctcgagcatatcgatgctaagggcgccatctcggccctggcggtgctgcag
ggcttcgtgcgcaatcagggcgatggctgggactacatgctggcctatctcgaccgcttc
ctcgacgacagggcccaggcgccggccgaggtcggcgagggcggcgggccggccggctcg
ccccatggcatcatccacgcccaggccgatatccttggccagcgcgtcgccgagcttcac
cacgccttcgccaccccgaccgaggacccggccttttccgccgaagccgtcgggccggag
gatctggcgagctggcgcgagcaagtgcgcacccaggcggcccaggcccgtcaggccctt
gacaccgccttgcccgggctgtccgcagaggtggcggggctggtcacccgactgctggac
tgctgggagcggatcgacgcccgcgtcgacgcgccgatttctttggccgaggggctggtc
aaaacccgcatccatggcgaccttcatctggggcaggtggtggtggtgcgcgatgacttc
catattctcgatttcgagggcgagccggtgaagggactgagtgagcggcgcgacaaacac
tgcccgttgaaagacgtggccggcatgcttcgctcgttcgattacgcggcgtggtcggcg
gcgctgagcttccgccaaacccatgccgaggtgcggatcgacgtactgcccgcgcttggc
gtttggcaggaggaaatccgcgaggctttcctcgccggctatgaccgggccatcgccgga
tgtccctcggttccggcccttgaggaggggcgaagggacctcctttcactattcatgctg
gaaaaagccctctatgaggtatcttacgaagccgccaatcgtccggactggttacgaatt
cccatcggcggcgttttgcgcctgcttggagaggggccatcggacgagatcaaaccgcgt
tga

DBGET integrated database retrieval system