KEGG   Ralstonia solanacearum CFBP2957: RCFBP_21103Help
Entry
RCFBP_21103       CDS       T01272                                 

Definition
(GenBank) putative maleylacetoacetate isomerase (maiA)
  KO
K01801  
maleylpyruvate isomerase [EC:5.2.1.4]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
Tyrosine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsc00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    RCFBP_21103
Enzymes [BR:rsc01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.4  maleylpyruvate isomerase
     RCFBP_21103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3052156..3052806)
Genome map
AA seq 216 aa AA seqDB search
MAIKLYNYFRSSASFRVRIALEIKGLPYDYAPVHLLKGEQSAPDFVKLNPDALVPVLCDG
TEVLTQSLAIVEYLEETHPEPTLLPGSAADRAHIRAIALAIACEIHPLNNPRVLKYLKHT
FNVDDDARNEWYRHWVRLGFAALETRLSQSPRTGACCVGDTPTLADLCLVPQVFNGKRFD
VAVEDYPTLARIFSHCMAQPAFQRAAPAAQPDAASA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaagctgtacaactacttccgcagctcggcgtcgttccgcgtgcgcatcgcg
ctggagatcaagggcctgccgtacgactacgcaccggtccacctgctcaagggcgagcaa
tcggcgcccgacttcgtcaagctgaacccggatgcgctggtgccggtgctgtgcgacggc
accgaggtcctgacccagtcgctggcgatcgtcgagtatctggaagagacgcatcccgag
ccgacgctgctgccgggttccgcggccgaccgcgcgcacatccgcgccatcgcgctggcg
attgcctgcgagatccatccgctgaacaacccgcgcgtgctcaagtacctcaagcacacc
ttcaacgtggatgacgacgcccgcaacgagtggtatcgccactgggtgcgcctgggcttc
gccgcgctggagacgcgcctgtcgcagtcgccgcgcaccggcgcctgctgcgtgggcgac
acgcccacattggccgacctgtgcctggtgccgcaggtcttcaacggcaagcgcttcgac
gtggcggtggaggactacccgacgcttgcccgcatcttctcgcactgcatggcccagccg
gcgttccagcgcgccgcgcccgccgcccagcccgacgccgcgtccgcttga

DBGET integrated database retrieval system