KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1110Help
Entry
Rsph17029_1110    CDS       T00484                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh00500  Starch and sucrose metabolism
rsh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rsph17029_1110
Enzymes [BR:rsh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Rsph17029_1110
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Rsph17029_1110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459
Motif
Other DBs
NCBI-ProteinID: ABN76220
JGI: Rsph170291110
UniProt: A3PIQ4
LinkDB All DBs
Position
1:1147610..1150918
Genome map
AA seq 1102 aa AA seqDB search
MNQNVSPSTVAVRRTDGIDRSQTDWYKDAIIYQLHIKAFQDANGDGIGDFAGLMQRLDYV
QALGVTAIWLLPFYPSPLRDDGYDISDYRSINPSYGAMRDFKLFVQEAHKRGLRVITELV
INHTSDQHPWFQRARRAKKGSAARDWYVWSDTDQKFPETRIIFLDTEKSNWTWDPVAGAY
YWHRFYSHQPDLNFDNPRVLEEVLKIMRMWLEMGVDGLRLDAIPYLVEREGTNNENLPET
HDVLKKIRANLDQHFPDRMLLAEANQWPEDTRPYFGEGDECHMGFHFPLMPRMYMALAQA
DRHPITDIIRQTPEIPEGCQWGIFLRNHDELTLEMVTAEERDYMWRFYAEDSRARINLGI
RRRLAPLMKNDRRKIELLNQMLMSMPGTPIVYYGDEIGMGDNYYLGDRDGVRTPMQWSAD
RNGGFSRCNPQQLYLPTILDPVYGHQAINVEAQAADPSSLLNWTRRLIAVRKQHPAFGRG
SMSLLYPRNRKVLAYVRSHEGTDILCVANLSDTAQAVELDLARFRGAVPVELTGRSEFPP
VGDLPYMLTLPPYGFYWFILSDQQALPSWHQPMPETLPDFITLTTRDGRAETALTGRETR
QLEADVLPNWLPLQRWFGAKEEKISAVKLAVLGSLSADHALVRLEADVGGEVQQYFLPAS
ALWGEEQLRAGAPKLSFTLAKVRRGPQVGALIDGAYDEQMAQDMLEALRDSRKLSGAGGE
VVFEPGSGLAEIADPGEPRYLGAEQSNISIAFGDRMILKLYRRLRAGEQPDVEVARFLTE
VAGYTHTPRYLGVVSLRPAEGEATVLAAAFAFVANMGDAWRGLFDALVRDLGEFGGWSTA
EAPEVEKDGFSFPLTIPGLLGQRTAELHQAFATETDEAAFRMEPLTAQHLTGWAEGARRE
AEAMLSVLERQRTHLPDEVLPLAEALLARRDDLLARLDRVTGFEPSGALTRIHGDYHLGQ
VLLAQDDVAIIDFEGEPRRTLAERREKSSPLRDVAGMLRSFDYAAAAALARHEESFGPAS
ERAVERAEAWRQQAVADFLAAYEGASAGTASLPSDPALKEALLDLFLVQKAVYETSYELG
SRPAWVGIPLRGLLELLDRKPA
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagaacgtctctccctccaccgttgccgtccgccgcacggacggcatcgatcgc
agccagaccgactggtacaaggacgcgatcatctatcagctgcacatcaaggcgttccag
gacgccaatggcgacgggatcggtgacttcgcgggcctgatgcagcggctggattatgtg
caggcgctgggcgtgaccgcgatctggctgctgcctttctatccctcgccgctccgcgac
gacggctacgacatctcggactatcgctcgatcaacccgtcctacggcgcgatgcgcgac
ttcaagctgttcgtgcaggaggcgcacaagcgcgggctgcgcgtcatcaccgagctcgtc
atcaaccacacctccgaccagcatccctggttccagcgggcccggcgggcgaagaaggga
tcggccgcgcgcgactggtatgtctggagcgataccgaccagaaattccccgaaacgcgg
atcatcttcctcgatacggaaaagtcgaactggacctgggatccggtggcaggcgcctat
tactggcaccgcttctattcgcaccagcccgacctgaacttcgacaatccccgtgtgctc
gaggaagtgctcaagatcatgcgcatgtggctcgagatgggcgtcgacgggctccggctc
gacgcgatcccctatctggtcgagcgcgagggcaccaacaacgagaacctccccgagacg
cacgatgttctcaagaagatccgggccaacctcgaccagcatttccccgacaggatgctg
ctcgccgaggcgaaccagtggccggaggacacgcgcccctatttcggcgagggcgacgaa
tgccacatgggcttccatttcccgctgatgccgcggatgtacatggcgctggcacaggca
gaccggcatccgatcaccgacatcatccgccagacgcccgagatcccggaaggctgccaa
tggggcatcttcctccggaaccacgacgagctgacgctcgagatggtgacggccgaagag
cgcgattacatgtggcgcttctatgccgaggattctcgggcgcggatcaatctcggcatc
cggcgcaggctggcgccgctgatgaagaacgaccggcgcaagatcgagcttctgaaccag
atgctgatgtcgatgcccggcacgcccatcgtctattacggcgacgagattggcatgggc
gacaactattatctcggcgaccgggatggtgtgcggacgcccatgcaatggtcggccgac
cgcaacggcggcttctcgcgctgcaatccgcagcagctctacctgccgaccatcctcgat
ccggtctatggccatcaggcgatcaacgtcgaggcgcaggcggcggacccgtcgtcgctg
ctgaactggacgcgccgcctgatcgcggtgcgcaaacagcatccggccttcgggcgcggc
tcgatgagcctgctctatccgcgcaaccgcaaggtgctggcctatgtccgcagccacgag
ggcacagacatcctctgcgtggcgaacctctcggacacggcgcaggcggtcgagctggat
ctcgcccggttccgcggcgcggtgccggtcgagcttacgggccggtcggagtttccgccg
gtgggcgatctgccctacatgctgacgctgccgccctacggcttctactggttcatcctc
tccgaccagcaggcgctgccgagctggcaccagccgatgcccgagacgctgccggatttc
atcacgctcacgacgcgcgacgggcgggccgagacggcgctcaccgggcgcgagacgcgc
cagctcgaggccgacgtgctgccgaactggctgccgctgcaacgctggttcggcgccaag
gaagaaaagatcagcgccgtgaagctggccgttctgggctcgctgtcggccgatcatgcc
ctcgtccggctcgaggccgatgtgggcggcgaggtgcagcagtatttcctgcccgcctcc
gcgctctggggcgaggagcagctccgggccggggcgcccaagctgagcttcacgctggcc
aaggtccggcgcgggccgcaggtgggcgcgctcatcgacggggcctatgacgagcagatg
gcgcaggacatgctcgaggcgctgcgcgacagtcgcaaactgtcgggtgccgggggcgag
gtggtgttcgagccgggctcgggactggccgagatcgccgacccgggcgagccgcgctat
ctcggggccgagcagtcgaacatctcgatcgccttcggcgaccgcatgatcctgaagctc
taccgccgcttgcgggcgggcgagcagccggacgtcgaggtggcgcgcttcctgacggaa
gtggcgggctacacccatacgccccgctatctcggcgtcgtgagcctgcgtccggcggag
ggcgaggcgaccgtcctcgccgcggccttcgccttcgtggccaacatgggcgacgcctgg
cgcggcctcttcgacgcgctggtgcgggatctgggcgagttcggcggctggagcacggcc
gaggcgccggaagtggagaaggacggcttctccttcccgctcaccattccgggccttctc
ggccagcgcacggccgagctgcatcaggccttcgccaccgagacggacgaggcggccttc
cggatggagccgctcacggcccagcatctgaccggctgggccgagggggcgcggcgcgag
gccgaggccatgctgtcggtgctcgaacggcagcggacgcacctgcccgacgaggtgctg
cccctggccgaggcgctgctcgcgcggcgcgacgacctgctggcgcggctcgaccgcgtc
accggcttcgaaccctcgggcgcgctgacccgcatccatggcgactaccatctggggcag
gtgctgcttgcgcaggacgatgtcgccatcatcgacttcgagggcgaaccgcgccgcacg
cttgcagagcgccgcgagaagtcctcgccgctccgcgacgtggcggggatgctgcgctcg
tttgactatgccgccgccgccgccctcgcacgtcacgaggagagcttcggcccggcgagc
gagcgggcggtggagcgggccgaggcctggcggcaacaggcggtggccgatttccttgcc
gcttacgagggcgcgtccgcgggcaccgcgagcctgccctccgacccggcgctgaaggag
gcgctgctcgatctcttcctcgtgcagaaggcggtctacgagacctcctacgaattgggc
agccgtcccgcctgggtcggcatcccgctgcgcgggcttctggaactgctggacaggaaa
cctgcatga

DBGET integrated database retrieval system