KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1885Help
Entry
Rsph17029_1885    CDS       T00484                                 

Definition
(GenBank) Kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsh00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    Rsph17029_1885
Enzymes [BR:rsh01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Rsph17029_1885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:1996557..1997840
Genome map
AA seq 427 aa AA seqDB search
MPRAGRPAKGRGALRPRAICRYLRCAEWEGRMTDFEATRAMFDLPEGVIYLDGNSLGPLP
RAAAARVAGCVTEEWGGMLITGWNRAGWMEMPRRLGDRIGRLVGAEPGTVVLGDTLSIKV
FQALAAACEMRPDRRVILSDSGNFPSDLYMAEGLCRMLGDRELRVVAPEALEDSIDENVA
AILVTEVDYRTGRRHDMAALTARAHAAGALAIWDLAHSAGALPVRLAEEGADFAVGCTYK
YLNSGPGGPAFIYVAPRHGERAVPALSGWLGHEAPFAFDPAYRPARGVERMRVGTPPVIQ
MAALDAALDVWEGVAMADLRARSLELTDLFIAEVEARCPDLVLATPRTHERRGSQVSFRH
PEAYPIMQALIARGVIGDFRAPDILRFGFTPLYIGASEVSRAAEILGEVMAGRLWDREDY
RRRAAVT
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgccacgggccgggcgccccgcaaagggccgaggcgccttgcggccccgcgccatttgc
cgctacctccgttgcgcagaatgggagggacgcatgacggatttcgaggcgacgcgggcg
atgttcgacctgcccgagggcgtgatctacctcgacggaaactcgctcggtccgctgccg
cgggcggcggcggcgcgggtggcgggctgcgtcaccgaggaatggggcgggatgctcatc
accggctggaaccgcgcgggctggatggaaatgccgcggcggctgggcgaccggatcggc
cggctggtgggggcggagcccgggacggtggttctgggcgacacgctctcgatcaaggtc
ttccaggcgctggccgcggcctgcgagatgcgtcccgaccggcgggtgatcctgtcggac
agcggcaactttccctcggatctctacatggccgaggggctctgccggatgctgggcgac
cgcgaactgcgcgtggtggcgcccgaggcgctcgaggattcgatcgacgagaacgtggcc
gcgatcctcgtgaccgaggtggattaccgcaccgggcggcggcacgacatggcggccctc
accgcccgggcccatgccgcgggcgcgctcgcgatctgggatctcgcccattccgccggc
gccctgcccgtccggctggccgaggagggcgcggacttcgcggtgggctgcacctacaag
tacctgaactccggccccggcgggcccgccttcatctatgtggctccccgccacggcgag
cgcgcagtgcccgcgctttcgggctggctcgggcatgaggcgcccttcgccttcgatccc
gcctaccgcccggcgcgcggggtcgagcggatgcgggtgggcacgccccccgtgatccag
atggcggccctcgatgcagcgctcgacgtctgggagggcgtggcgatggccgatctgcgg
gcgcgctcgctggagctgaccgacctcttcatcgccgaggtcgaggcgcgctgcccggac
ctcgtgctcgccacgccgcgcacgcacgagcgccgcggctcgcaggtgagcttccgccat
cccgaggcctatccgatcatgcaggcgctgatcgcgcgcggcgtgatcggcgatttccgc
gcgcccgacatcctgcgcttcggcttcacgccgctctatatcggcgcctccgaggtgagc
cgcgcggccgaaattctcggcgaggtgatggcgggccggctctgggaccgcgaggactat
cgccggcgcgcagccgtgacctga

DBGET integrated database retrieval system