KEGG   Ralstonia solanacearum Po82: RSPO_c01831Help
Entry
RSPO_c01831       CDS       T02005                                 

Gene name
gstA
Definition
(GenBank) glutathione s-transferase protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RSPO_c01831 (gstA)
Enzymes [BR:rsn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RSPO_c01831 (gstA)
Transporters [BR:rsn02000]
 Other Transporters
  Pores ion channels [TC:1]
   RSPO_c01831 (gstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1909580..1910239
Genome map
AA seq 219 aa AA seqDB search
MAKTPTTLTISSRNYSSWSFRGWLLAKLAGLEFDTVTVPIDDAARAELLLLSPSILVPCL
QHDGIKVWDTLAIAEYLNEIRPQAHLLPADRAARAHCRAVCGEMHSGFSALRSALPMNLR
AHFPDFRVWARAQDDIERIVAIWRACLRGYGGPWLFGEAIGMADAMYAPVVTRFLTYDVK
LDPDIAAYCATVLKHPFVMEWMDAARAETEEIDELDVEF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggccaagacgcccaccacgctgacgatcagcagccgcaactactcgtcgtggtcgttc
cgcgggtggctgctggcgaaactggccggcctcgagttcgacacggtgaccgtgccgatc
gacgatgcggcgcgggccgaactgttgctgctgtcgccgtccattctcgtgccgtgcctg
cagcacgacggcatcaaggtgtgggacacgctggcgattgccgaatacctcaacgagatc
cgcccgcaggcccatctgctgccggccgaccgcgccgcgcgggcgcattgccgcgccgtc
tgcggtgagatgcattccggcttcagcgcgctgcgctcggccctgccgatgaacctgcgc
gcacatttccccgacttccgcgtctgggcgcgcgcgcaggacgacatcgaacgcatcgtc
gccatctggcgcgcgtgcctgcggggctacggtggcccatggctgttcggcgaggctatc
ggcatggccgatgccatgtacgcgccggtggtcacgcgctttctcacctatgacgtcaag
ctcgatccggacatcgccgcgtactgcgcgaccgtgctcaagcatccgttcgtgatggag
tggatggacgcggccagggcggagaccgaggagatcgacgagctggacgtggagttctga

DBGET integrated database retrieval system