KEGG   Ralstonia solanacearum GMI1000: RSp0641Help
Entry
RSp0641           CDS       T00071                                 

Definition
(GenBank) probable non ribosomal peptide synthetase protein
Organism
rso  Ralstonia solanacearum GMI1000
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
megaplasmid:782247..802916
Genome map
AA seq 6889 aa AA seqDB search
MSKNDQTLPRDPDTLVALLESLAATRPDDTAYVFLQDGDEGESRMTYAELHDAARRVAVH
LLGNGCGQDDPVLLIFNPGLDYICAFFGCLYAGAIPVPAYPPAHARRLERLQAVAVDAGA
RFALTVSEELSRIASFETQQGKRLPVERWLAIDRADSDAGDWTDPGLDGSRIAFLQYTSG
STGAPKGVMVTHRNLFANVAAMTAEGRMGRDEVMVYWLPPYHDFGLIGGILQPLVLGCTV
VLMRPAAFLLNPYRWLKAITDYRATVAGAPNFAFDLCVRSITPAQRATLDLSRLRVLASG
AEPVRPGTLEKFTAAFAPHGFNPAAWFAAYGMAEATLLIAFGWAIRFQGQPRCLPFSRLA
LQKGMAVAADDEADRIALASHGSALTGHQLAIVDPETLRRCEPGRVGEIWVSGPSVAQGY
WRRDEDSRRSFAGEMAEPADGERYLRTGDLGFLHAGELYICGRLKDLIILNGLNIYPQDV
ELAAFESHARLRENGTIAFAVDRDDTEQLVIVQELEFRQPVEPGMFECMASAVSMNVGVT
PDVIVLVKAGAIPRTSSGKIRRQQCRADFLADRLPAMARWDRPVLAASPVPVAPGAPVLA
AAREPVAVSAAVVEARLRAELAARLGLDAEAIDREQPFAFYGLDSMSAVQLAEALSVWMR
VTVAPVVFWEHPNIARLAGFLAELSAAGQGDRHPAEAAPDAPAQAADAPIAIIGLGCRFP
GADDADAFWDALDGQVDAIGAVPQARRAAGTFDEPRAELPSQVRLGGFLDRVDAFDAAFF
SISPLEAARMDPQQRLALEVAWQALEDAGIAASGLAGSTTGVFIGISTHDYENLQDRAGS
ELSVYSATGNAGSIVANRLSYCLDLRGPSLAIDTACSSSLVAVHAACQSLRDGESTLALA
GGVNLVLSTLSSEPFARAGMLSPDGRCKAFDASANGYVRGEGCGVVVLKRLSDALRDGDP
VRAVILGSAVMQDGRGNGLIAPNGSAQAAVVRQALARARLRPEQIGYIEAHGTGTALGDP
IELNALKSVFAHAPEAGRCAVGSVKTNIGHLEAAAGVASLIKVVLALEHETLPANLHYRE
PNPHCALDGSALSIVSRSQPWPGNAGRRHAGISSFGFGGTLAHMIVAQAPPAATAHGAQW
PWHLLSLSAKTAPALEAMTEAVAGQLRDLPDAALADAAYTHQAGRNAFAWRRMLVARDRE
DAAEALRARDPRRVFTAQVRPAVPAPVVFMFPGQGAQQVGMARELYQEIAAFRAVVDRCA
QVLRERAGFDLIQSLYGDGDPEASHLALTRTEAAQPALFVIEYALARLWMDWGMKPAALI
GHSVGEYVAACLAGVFSLDDALVLVAERGRLMQSLPAGAMLSVALDEASLRAQLDGTLAL
AAVNGRQRCVVAGETTAVAALERRLDAQGISHRRLATSHAFHSHMTEPILPAFADSVARL
TLRAPAIPFVSNLTGAWIEPAQATDPGYWAAHLRGTVRFADGLQTLMQGGPHAWIEVGPG
QTLSALARPCAGDALVLPSLGGGEGPKSDLAVLLGSAGQLWLAGQALDWRALYAGQQRRT
LRLAPYPFQRERHWLDAPAAPQQDAQASVEPSRAVTSMPVAAAMSSSVSNSASRAQAIQG
ALRGMVAKMLHADVARVDPDLPLLELGADSLMMVQAIGSIEQTYGVTVTVRQLFEELTTI
AAIADYVDRQMPREARLEAAAEAPATVPAAAVMPMPAPAPAAPVAAIAVDARPDAVPPLA
AIPALPQSSLERLLSQQLDALSQLTARQLALFQGGTVAATAGGPASVAGETSPVVPTVMP
AAVPVVAPAPASTAAPGGTHKPYVPYQPVRVTAKADPFRDLSARQRAYLDGFVARYTERT
RGSKALVQRYRPVLADNRVSAGFRFSTKEMLYPVVSERSEGAYLWDPDGNVYIDLTMGFG
VNLFGHRPAFVQEALDAQLKTGLELGPQTRLAGEVAELVTRLTGLERVAFCNSGTEAIML
ALRLARTVTRRDKIVVFAGSYHGWSDDTLMVADGAGTVAMAPGLQPGASAHTIVLDYGAP
ESLARIREHAHELAAVLVEPVQSRRPHWQPREFLHALRELTREHGIALIFDEIIMGFRLH
PGGAQAWYGIEADMATYGKVIGGGMPAGMVAGSAAYLDAVDGGQWRYGDASYPQADTTFY
AGTFCKHPLMLVAARAVLQRLAQEGPALQETLNARTAELVRRLNGVFADARVPVRAVHCG
SSFRLLEASPSIDLLYYHLLAGGLYIWEGRGMFLSTAHSDADVDRVVEIFADSVRAMLDG
GFFEDGAPTPPSGGGGRSPFAAARVGGPASTDAPVAPALAEAAVARLSAAPVPPATGGGI
RFGISFFGHYASGYDAQKYRLLFEAARYADAGGFSSLWLPERHFHAFGGLSPNPSVLSAA
LARETSHIQLRAGSVVLPLHHPVRVAEEWSMVDNLSQGRVGIACASGWHPNDFVFAPEAF
GSHRELMFQRIEQIQALWRGEPLRVRDGSSREIEVKLFPMPRQPELPIWITIVGNPDTYR
RAGEIGAGILTNLMGQTVEALECNLALYRQALVEHGHGVERSRVSVLLHTFVCEDAAEAR
AVARAPFIHYLRSSVGLFQNMVDSLGLQADVSTLSEDDRDYLLSVAYERYVEHSALIGSP
ATCRALVERLQAIGVDEIGCFIDFGVDPDTVLGRLDQLALLKQSFETAAVDDDAAERYPL
VPAQKGIWFECQISHEAALSYNTTTVLGLRGALDHAALARALQQVVDRHAALRSVVEADG
EHQRVLPAVEVGLPLVDFSREADRDAAIGQWFVDNNHRPMDPGHGPLVRACLLRKGEAEH
LLAITFHHVIIDGYSQEIVLQELAACYRAACRGGAPGLPAASPFREQVERHQAYLRSDRY
QQDRAYWRGQFGSLPPSLELSGRHARPSAPSHRARRHHLTIDGERYARLQQLSRKLGGTL
FMTMLAGVAVLLQRLSGQAQMVIGVPMVVGRAEGSEASLVGCTLNLVPVRCDGSGDPSFA
EFLGRIKRSVLEAHAHADYPFGHLLRDLDLRASQRRPLAPVLFNLNRSLALPQFDALQAW
LEQSPISFSPDDLTIDVMQLPDRLQVMFQYQEVLFEHEAIERMAAQFVQLLDGIVADPAC
SIGRLALLSAEERRQIVDVWNAGEPVPEPSETLHAVFEAQVRRTPEAIAVEHEGWRVSYA
ELNARANRVAHALIGLGVGPDARVGLCAERSVELVIGLLGILKAGGGYVPLDPSYPRDRL
AYMLEDSAPVAVLAQSNTREPLGALSVPVLDLENPLEGEAEHDPQVTGLEPNHLAYVIYT
SGSTGQPKGVLVEHRQVARLFTSTQPWFGFGAEDVWTLFHSFAFDFSVWELFGALLHGGR
LVVVPKLTARSPQAFYALLCEAGVTVLNQTPSAFRQLMAAQQEAPAARHRLRQVILGGEA
LEVGALRPWYERAENAGTQLANMYGITETTVHVSYRALEAADAQGTGSPIGRRIPDLRVY
VLDAHGEPVPVGVTGEMYIGGAGVARGYLNRPELTAERFVVNPFHGEGRERMYRTGDLGR
WLPDGSLEYQGRADAQVKLRGFRIELGEIEASLSQCAGVREAVVTVREDVPGEQRLVAYY
VSGEAIEAQALREQLQGSLPAYMVPAAYVRLAHLPLTSNGKLDRKGLPAPEGHAYASTAY
EAPQGEVEQTLAGIWQTLLGVERVGRHDDFFALGGHSLQAVRLVTQVRVQLGAELGLTAL
FAQPSLSAVAQAIVRGQGSALQAITAADRSEALPLSFAQQRLWLLAQMEGGSEAYHIPVG
LRLKGELDEDALGRALDRIVARHEALRTRFEVREGQAIQRVASADVGFALDRVDLQGQAD
REQTLAALSEREANTPFDLEQGPLIRGCLVKLGEQEHVLLITMHHIVSDGWSQGVLAREL
GALYEAYRSGGEDPLPALPIQYADYAVWQRRWLEGGELQRQGAYWEQALAGAPTLLSLPT
DRARPAQQDYAGGSVEVVFDETLSADLKRLSQRHGTTLFMTVLAGWSALLSRLSGQEEVV
VGSPVANRTRSEVEGLIGFFVNTLALRVNVGSATVSELLDRVKAKVLEAQAHQDLPFEQV
VERVKPVRSLSHSPIFQAVFSWHNTEAVDLSLRALSLESLARENATAKLDIQLELAEADG
RIVGTLNYATALFERSTAQRYADYLQRMLQAMVADDGQQVGRIALLGEAERAQVLQAWNA
TERAWPAATLPALFEAQVMRTPDAVALKHADQQVSYRELDARANRLAHHLRELGVAADVL
VGLCVDRSIEMIVGLLGILKAGGAYVPLDPDYPQARLAYIFQDAMLSVLVSKRALAQRLP
IAWTQVVELDDAEPAWADYPPTPPQVQGEPGQLAYVIYTSGSTGQPKGVAVTHQGVASLV
YSQCERFGVSSQSRVLQFASISFDAAVSEIGMGLLCGACLVLAPAQALMPGAALTHLLDR
ERITHVTLPPAVLALMPEQALPADCHLIVAGEACPPSLVRLWSEGRTMINAYGPTEATVC
ATMSRALTAQDAPSIGGPIGNVRVYVLDAYLQPVPVGVTGELYIAGSGLARGYWQRAGLT
AERFMANPFALGERMYRTGDLGRWLPDGSLEYQGRADAQVKLRGFRIELGEIEARLSQCA
GVSEAVVTVREDAPGEQRLVAYYVSGEAIEAQTLREQLQSRLPEYMVPAAYVRLEHLPLT
PNGKLDRKGLPAPEGQAYASTAYEAPQGEVEQTLAGIWQTLLGVERVGRHDDFFALGGHS
LQAVRLVAQVRTQLGAELGLTELFAQPSLSAVAQAIVRGQGSALPAITVADRSGPLPLSF
SQQRLWFLAQMEGGSEAYHIPVGLRLKGELDEDALRRSLDRIVARHEALRTRFVTEEGQA
VQRVASADVGFALDCVDLQGQADREQALATLSEREANTPFDLAHGPLIRGRLVKLGEQEH
VLLITMHHIVSDGWSQGVLARELGSLYEAYRAGNADPLPALPIQYADYAVWQRRWLEGGE
LQRQGTYWEQALAGAPTLLSLPTDRARPPQQDYAGGSVEVVFDAELSTGLRTLSQRHGTT
LFMTVLAGWSALLSRLSGQGEVVVGSPVANRTRSEVEGLIGFFVNTLALRVEVGGATVSE
LLERVKAKVLEAQAHQDLPFEQVVERVRPVRSLSHSPVFQAALSWLNTEAVGLSLELEGL
TIEGVDAGQAAAKFDLTLELRETSEGLAGSLDYATALFDRATIERYLGYLHRLLKAMAAD
DSQEVNRIALLDEGERTQLLESWNETKAPYPRASTIHGLFEAQVRRTPEAIAVVHEGQQV
SYAELNARANRVAHALRRLGVGPDARVGLCAERSVELVVGLLGILKAGGGYVPLDPSYPQ
DRLTYMLEDSAPVAVLTQSNTREQLGALSVPVLDLDGPLEEAEHDPQVTGLEPHHLAYVI
YTSGSTGRPKGVMNEHRGVVNRLWWAQQTYRLDASDRVLQKTPFGFDVSVWELFWPLLAG
ARLVMARPEGHKDPAYLAATIEQAGITTLHFVPSMLQLFLDQVEAGRCQGLRRMLCSGEA
LSHALQQRSLARFPHSELHNLYGPTEAAIDVTAWRCNAEIHPGVVPIGRPIANTQMYVLD
GHQQPVPLGVTGEIYIGGIGVARGYLNRPELTAERFVVNPFHGEGRERMYRTGDLGRWLP
DGSLAYQGRADAQVKLRGFRIELGEIEARLSQCAGVSEAVVAMREDVPGEQRLVAYHVSD
EAIEAQTLREQLQASLPEYMVPAAYVRLEHLPLTPNGKLDRKGLPAPDGQAYASAAYEAP
QGEVEQTLAGIWQTLLGVERVGRHDDFFALGGHSLQAVRLVAQVRTQLGAELGLTELFAQ
PSLSAVAQAIVRGQGTALPAITVADRGEALPLSFAQQRLWFLAQMEGGSEAYHIPVGLRL
KGELDEDALRRSLDRIVARHEALRTRFEVQEGQAVQRVASADVGLTLDWADLSAEAASEH
QLGLLAEAWARAPFDLEQGPLIRGRLVKLGEQEHVLLITMHHIVSDGWSQGVLARELGAL
YEAYRAGNSDPLPALPIQYADYAVWQRRWLEGGELQRQGTYWEQALAGAPTLLSVPTDRA
RPPQQDYAGGSVEVIFDETLSAGLRKLSQRHGTTLFMTVLAGWSALLSRLSGQEEVVVGS
PVANRTRSEVEGLIGFFVNTLALRVEVGSATVSELLGRVKSRVLEAQAHQDLPFEQVVER
VRPVRSLSHSPVFQAALSWLNTEAMVLKLDGLTIEHLADESYTAKFDLSLALREHDGRIA
GSLDYATALFDRETIERYLGYLHRLLAAMVENDSQQVSRIGLLDEGERAQLLESWNETKA
AYPDASTIHGLFEAQVRRTPEAIAVEHEGQQVSYAELNARANRVAHALRRLGVGPDARVG
LCAERSVELVVGLLGILKAGGGYVPLDPSYPQDRLAYMLEDSAPVAVLAQSNTREQLGAL
SVPVLDLDRPLLEEAEHDPQVTGLEPHHLAYVIYTSGSTGRPKGVMVEHRGLSNLLDWYL
EDLGLRSDDTVLLVSSYSFDLTQKNILGPLLAGGRLHLAGPFVPDALVAQIRREGITHIN
LSPSAFHALIDAAGAEGLGGLRRVVLGGEPIQPARLQGLPEPRPRFINSYGPTECSDVVA
WHALDAELDRYRAASVPLGRSVRNVRLYVLDAHRQPVPTGVAGEIYVGGAGVGRGYRNLP
ELTGACFLADPFHGEGQARMYKTGDLGRWLANGSLEYLGRSDDQVKLRGFRVELGEIGAS
LARCDGVREAAVLAREDAPGEPRLVAYYVAEPGAAVEASALRRHMQAQLPEHMVPAAYVR
LEHLPLTPNGKLDRRALPAPAADAYARRRYVAPQGDVETMLAELWQDLLGVERVGRHDDF
FELGGHSLLAMSLMARMDELGLSADVRVLFTQPTLAGLAAEVEPMEIVL
NT seq 20670 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagaacgatcaaaccctcccccgggatccggacacgctggtagccctgctggaa
tcgctcgcggctacccggcctgacgacacggcctacgtgttcctgcaggacggcgacgaa
ggcgagtcgcggatgacctacgccgaattgcacgacgcggccaggcgggtggccgtccat
ctgctgggaaacgggtgcggccaggatgatccggtgctgctgatcttcaatccggggctc
gattacatctgcgcgtttttcggctgcctgtatgccggcgccattcctgtgccggcctat
ccgcccgcgcatgcccgccggctggagcgattgcaggcggtggccgttgacgcgggcgcg
cggttcgcgctgaccgtcagcgaggagctgtcgaggatcgcgtcatttgaaacgcagcag
ggcaaacgattgccggtcgagcgctggctggcgatcgaccgggcggacagcgatgcgggc
gactggaccgaccccgggctggacggctcgcgcatcgcgttcctgcaatacacgtccggt
tccaccggcgccccgaagggcgtcatggtgacccaccgcaatctgttcgccaatgtcgcg
gcgatgaccgccgaggggcggatggggcgcgacgaggtcatggtctactggctgccgccg
taccacgacttcggcctgatcggcggcatcctgcagccgctggtgctgggctgcacggtg
gtgctgatgcgcccggcggcgttcctgctgaacccctatcgctggctcaaggcgatcacc
gactatcgcgccacggtggccggcgcgcccaactttgccttcgacctgtgcgtgcgctcg
atcacgccggcacagcgggcaacgctggacttgagccgcctgcgcgtgctcgccagcggc
gccgagccggtgcgcccgggcacgctggagaaattcaccgcggccttcgcgccgcacggc
ttcaatccggcggcctggttcgcggcctacggcatggccgaggccaccctgctgattgcg
tttggctgggccatccggttccaggggcagccgaggtgcctgccgttttcgcgcttggcc
ctgcagaagggcatggcggtcgcggccgatgacgaagcggaccggatcgccctggccagc
cacggcagcgccctgaccgggcaccagctcgccatcgtcgatcccgagacgctgcggcgc
tgcgagcccggccgcgtcggcgagatctgggtgagcggccccagcgtcgcgcagggctat
tggcggcgcgacgaagacagccggcggagctttgccggcgagatggcggaaccggccgac
ggcgagcgctacctgcgcaccggcgatctcggtttcctgcacgcgggcgagctgtacatc
tgcggtcgcctgaaggacctgatcattctgaacggcctcaacatctatccgcaggatgtg
gagttggccgcgttcgagagccacgccaggctgcgcgagaacggcaccatcgccttcgcc
gtggaccgggacgacacggagcagctcgttatcgtgcaggagctggagtttcgccagccg
gtggagcccggcatgttcgagtgcatggcctcggccgtgtcgatgaacgtcggcgtgacg
cccgacgtcatcgtgctggtgaaggcgggggccattccgcgcacgtccagcggcaagatc
cgccggcagcagtgccgggcggacttcctggcggaccgcctgccggcgatggcccgctgg
gatcgtccggtgctggcggcttcgccggtgccggttgcgccgggggcgccggttctggcg
gccgcgcgcgagcctgtcgcggtgtcggccgcggtggtcgaagcccggctgcgcgccgag
ctggccgcgcggctggggctggatgccgaggcgatcgatcgcgaacagccgttcgcgttc
tacggtcttgactcgatgtcggcggtgcagctggccgaggcgctgtcggtctggatgcgg
gtgacggtcgcgccggtggtgttctgggagcatccgaatattgcgcggctggcgggcttt
ctggccgagctgtccgctgccggacagggcgatcgccatccggccgaggcggcgccggac
gcgccggcgcaggcggccgacgcgccgatcgccatcatcggcctgggctgccgctttccc
ggcgcggacgacgccgacgcattctgggacgcgctggacgggcaggtggatgcgatcggc
gcggtgccgcaggcgcgccgtgcggcgggcacctttgatgagccgcgcgccgagcttccg
tcgcaggtgcgtctggggggctttctcgaccgggtcgatgcgttcgacgcggcctttttc
agcatttcgccgctcgaagccgcgcgcatggatccgcagcagcggctggcgctggaagtg
gcctggcaggccctggaggacgcgggcatcgcggcttccgggctggccggctcgaccacc
ggcgtcttcatcggtatctccacccacgactacgaaaacctgcaggaccgcgcgggcagc
gaactgagtgtgtattcggccacgggcaacgcgggcagcatcgtggccaaccgcttgtcg
tattgccttgacctgcgcgggcccagcctggccatcgacacggcgtgctcgtcgtcgctg
gtggcggtgcatgcggcgtgccagagcctgcgcgacggcgagtcgacgctggcgctggcc
gggggcgtgaacctggtgctgtcgacgctgtcgagcgagccctttgcccgcgccgggatg
ctctcgccggatgggcgctgcaaggccttcgatgccagcgccaacggctatgtgcgcggc
gagggctgcggcgttgtggtgctgaagcggctgagcgacgcgctgcgtgacggcgatccg
gtgcgcgcggtcatcctgggctcggcggtgatgcaggatgggcgcggcaacggcctgatc
gcccccaacggcagcgcgcaggccgcggtggtgcgccaggcgctggcccgcgcgcgcctg
cggccggagcagatcggctacatcgaggcccacggcaccggcaccgcgctcggtgacccg
atcgagctcaacgcgctcaagagcgtgtttgcgcatgcgcccgaggcgggccgctgcgcg
gtcggctcggtcaagaccaacatcggccacctggaggcggcggccggcgtggccagcctg
atcaaggtggtgctggccctcgagcacgagaccctccccgccaatctgcactaccgcgag
cccaatccgcattgcgcgctggatggcagcgcgctgtccatcgtgtcccgttcgcagccc
tggccgggcaacgcgggccgccggcatgccggcatcagctcgttcggcttcggcggcacc
ttggcccacatgatcgtggcgcaggcgccgcccgccgccaccgcgcacggggcacagtgg
ccctggcatctgctgagcttgtccgccaagacggcccccgcgttagaggcgatgaccgag
gccgtggccgggcaactgcgggacttgccggacgccgccctggccgatgcggcctatacc
caccaggccggccgcaacgcctttgcctggcggcgcatgctggtggcccgcgatcgcgaa
gacgcggccgaggcgctgcgcgcgcgcgatcctcggcgcgtgttcacggcgcaggtgcgg
ccggccgtgccggcaccggtggtgttcatgtttcccgggcagggcgcgcagcaggtcggc
atggcgcgcgagctgtaccaggagatcgccgcgttccgcgccgtggtggatcggtgcgcg
caggtgctgcgcgagcgagcgggattcgatctgatccagtcgctctacggcgacggcgac
cccgaggcgagccacttggcgttgacccggaccgaggcggcgcagcccgcgctgttcgtc
atcgagtacgcgctcgcccggctgtggatggactggggcatgaagccggccgcgctgatc
ggccacagtgtgggcgaatacgtggcggcctgcctggccggcgtcttttccctcgacgac
gccctggtgctggttgccgagcgtggccgcctgatgcagagcctgcccgccggcgcgatg
ctgagcgtggcgctggacgaagccagcctgcgcgcgcagctggatgggacgctggccctg
gccgcggtcaacggccgccagcgctgcgtggtggccggcgagacaacggcggtcgcggcg
ctggagcgccggctggatgcccagggcatctcgcatcggcgcctggcgacttcgcacgcg
ttccattcgcacatgacggagccgatcctgccggcctttgccgacagcgtggcccggctc
accctgcgggcgccggcgattcccttcgtgtccaacctgaccggtgcctggatcgagccg
gcccaggccaccgatccgggctactgggcggcgcatctgcgcggcacggtgcgctttgcc
gatggcctgcagacgctgatgcagggcgggccgcacgcctggatcgaggtgggcccgggc
cagacgctgagcgcgctggcgcgcccgtgcgcgggcgacgccctcgtgctgccctcgctg
ggcggcggcgagggccccaagtctgatctcgcggtgctgctgggcagtgccgggcagctc
tggctggcggggcaggcgctcgactggcgcgcgctctatgccggccagcagcgccgcacg
ctgcgcctggctccctatccctttcaacgcgaacgccattggctcgatgcgcctgccgct
ccccagcaggacgcgcaggcgtctgtcgagccctcccgtgccgtcacttccatgcctgtt
gccgccgccatgtcctcgtccgtttccaattccgccagccgtgcgcaagcgattcagggt
gccctgcgcggcatggtcgccaagatgctgcatgccgacgttgcgcgggtcgatcccgac
ttgccgctgctggagctgggcgcggactcgctgatgatggtgcaggccatcggcagcatc
gaacagacctacggtgtgacggtcaccgtgcgccaactgttcgaggaactgacgaccatc
gccgccatcgccgactacgtggatcggcagatgccccgcgaggcacgcctcgaggcggca
gcggaggcgccggccacggtgccggcggctgccgtgatgccgatgcccgcaccggcaccc
gccgcgccggtggccgcgatcgcggtcgatgcgcggccggacgccgtgccaccgcttgcc
gcgattcccgcgctcccgcagtcgtcgctggagcggctgctgagccagcagctcgacgcg
ctgtcgcagctgacggcccggcaactggccttgttccagggcggtacggtcgccgccacg
gccggtgggccggcatcggtggccggcgagacatcgcctgttgtgcccactgtcatgccc
gctgccgtgccggtggtcgcaccggcaccggcgtccaccgccgcaccgggcggcacgcac
aagccttacgtgccctaccagcccgtcagggttaccgccaaggccgatccgttccgcgac
ttgagcgcgaggcagcgcgcctatctggacggcttcgtcgcgcgctacaccgagcgcacc
cgcggctccaaggcgctggtgcagcgctaccggccggtgctggccgacaaccgggtctcg
gccggcttccggttctccaccaaggagatgctctatccggtcgtcagcgagcgctccgaa
ggcgcctatctctgggacccggacggcaacgtctacattgacctgaccatgggcttcggc
gtgaacctgttcggccatcgcccggcctttgtgcaggaagcgctcgatgcccagttgaag
accggcctggagctggggccccagacccgcctggcgggcgaggtggcggagctggtcacc
cggctgaccggcctggagcgcgtggcgttctgcaactccggcaccgaggcgatcatgctg
gccctgcgcctggccaggacggtgacccggcgcgacaagatcgtcgtgttcgccggctcg
tatcacggctggagcgacgacacgctgatggtcgccgacggcgccggcaccgtggcgatg
gcgcccggcctgcagcccggcgcatccgcccacaccatcgtgctcgactacggcgcgccc
gaatcgctggcacgcatccgcgagcacgcgcacgagctggccgcggtgctggtggagccg
gtgcagagccgccgcccccactggcagccgcgcgagttcctgcacgcgctgcgcgagctg
acgcgcgagcacggcatcgcgctgatcttcgacgaaatcatcatgggcttccgcctgcat
ccgggcggcgcgcaggcctggtacggcatcgaggccgatatggccacctacggcaaggtc
atcggcggaggcatgccggcggggatggtggccgggtcggccgcctatctcgatgcggtg
gacggcggccagtggcgctacggcgacgcctcgtacccgcaggcggacacgaccttctac
gcgggcaccttctgcaagcatccgctgatgctggtggcggcccgcgcggtgctgcagcgg
ctggcgcaggagggccccgcgctgcaggagaccctcaacgcgcgcacggccgagctggtc
cgccgcctcaacggggtcttcgccgatgcgcgggtgccagtgcgcgcggtgcactgcggc
tcgtcgttccgcctcctggaggcttcgccgagcatcgatctgctttattaccacctgctc
gccggcggcctgtacatctgggaggggcgcggcatgttcctgtccacggcgcacagcgat
gcggatgtggaccgggtggtcgagatcttcgcggacagcgtgcgggccatgctcgacggc
ggtttcttcgaggacggtgcgccgacgcctccgtccggcggcgggggccgttcgccgttc
gcggcggcgcgcgtcggtgggccggcgtcaaccgacgcgcccgtggcgcccgcgttggcc
gaggccgccgttgcccggttgtcggccgcgccggtgccgcccgcgaccgggggcggcatc
cgcttcggcatctcgttcttcggccactatgcgtccggctacgatgcgcagaagtatcgg
ctgctcttcgaggcggcccgctatgccgacgccggcggcttttcttcgctgtggctgccg
gagcggcatttccatgcgttcggcgggctctcgcccaatccttcggtgctgagcgccgcg
ctggcgcgcgaaacatcccacatccaactgcgcgcgggcagcgtcgtgctgccgctgcac
catccggtgcgggtcgctgaagagtggtcgatggtggacaacctctcgcagggccgggtg
ggcatcgcctgcgcgtccggctggcatccgaacgacttcgtgttcgcgccggaggcgttc
ggcagccatcgcgagctgatgttccagcgcatcgagcagatccaggcgctctggcggggc
gagcccctgcgggtgcgggacggttcgtccagggagatcgaggtcaagctgttcccgatg
cccaggcagccggagctgccgatctggatcaccatcgtggggaatccggatacctaccgc
cgcgctggcgagatcggcgcgggcatcctcaccaacctgatgggacagaccgtcgaggcg
cttgagtgcaacctcgcgctgtaccgccaggccttggtcgagcacggccacggcgtggag
cgcagccgcgtcagcgtgctgctgcacacctttgtctgcgaggatgccgccgaggcgcgc
gccgttgcccgcgcgccgttcatccactacctgcggtcgtcggtgggcctgttccagaac
atggtcgacagcctgggcctgcaggcggacgtgagcacgctcagcgaggacgaccgcgac
tacctgctgtcggtggcgtacgagcgctacgtggagcacagcgcgctgatcggcagcccg
gccacgtgccgggccctcgtggagcggctgcaggcgatcggcgtggatgagatcggctgc
ttcatcgatttcggcgtcgaccccgacacggtcctgggccggctcgaccagctggcgctt
ctgaagcaatccttcgagacggcggcggtggacgacgatgccgccgagcgctatccgctg
gtgccggcccagaaaggcatctggttcgagtgccagatcagccacgaggcggccctcagc
tacaacaccaccaccgtgctgggtttgcgcggcgcgctggatcatgcggcgctggcccgc
gcgctgcagcaggtcgtcgaccggcatgccgcgctgcgcagcgtggtcgaggccgacggc
gagcatcaacgcgtgctgccggccgtggaggtcgggctgcccctggtcgatttctcgcgg
gaggccgaccgcgacgcggcgatcgggcaatggttcgtcgacaacaaccatcggccgatg
gaccccgggcacggcccgctggtccgcgcctgcctgctgcgcaagggcgaggccgagcac
ctgctggcgatcaccttccaccacgtcatcatcgatggctattcgcaggagatcgtgctg
caggagctggcagcatgctaccgggcggcctgccgcggcggcgcgcccgggctgcctgcc
gcgagccctttccgcgagcaggtggagcgccatcaagcctacctgcgcagcgatcggtat
cagcaggatcgcgcctattggcgcgggcaattcggcagcctgccgccgtcgctggagctg
tcgggccggcatgcccggccgtccgcgccgagccatcgggcccggcgccaccatctgacc
atcgacggcgaacgctacgcgcggctgcagcagctcagccgcaagctgggcggcacgttg
ttcatgaccatgctggcgggcgtggccgtgctgttgcagcggctgtcggggcaggcgcag
atggtgatcggcgtgccgatggtggtcggccgtgccgagggcagcgaggccagcctggtc
ggctgcacgctgaacctggtcccggtgcgctgcgacggctcgggcgacccttcgtttgcc
gagttcctggggcggatcaagcgctcggtgctggaagcccatgcccatgccgactatccg
ttcggccacctgctgcgcgatctcgatctgcgcgccagccagcggcgtccgctggcgccg
gtgctgttcaacctcaaccgctcgctggcgctgccgcagttcgacgcgctgcaggcatgg
ctggagcagagccccatcagcttcagcccggatgacctgacgatcgacgtcatgcagttg
cctgaccggttgcaggtcatgttccagtatcaggaggtgctgttcgagcacgaagcgatc
gagcggatggccgcgcagttcgtgcaattgctcgatggaatcgtcgccgatccggcctgt
tcgatcggcaggctggcgttgctgagcgcggaagagcggcggcagatcgtcgacgtttgg
aacgccggagagcctgttccggagccatccgaaaccttgcatgccgtgttcgaggcccag
gttcgccgcacgccggaagcgattgcggtggagcacgaaggctggcgggtgagctacgcg
gaattgaacgcacgggccaaccgtgtggcgcacgcgctgatcggtttgggtgtgggcccg
gatgcccgagtgggcctgtgcgcggagcgcagcgtagagcttgtgatcgggctgcttggg
atattgaaggcaggcggaggttatgtgccgctggacccatcgtatccccgggatcgtctg
gcgtacatgctggaggacagcgccccggtggcggtgctggcgcagtcgaacacacgcgag
ccgttgggggcactgtcggtgccggtgttggatctggagaacccgctggaaggcgaggcc
gagcacgatccgcaggtgacgggcctggagccgaaccacctggcctacgtgatctacacc
tccggctcgacgggccagcccaagggcgtgctggtcgagcaccgccaggtcgcccggctg
tttacgtccacccagccgtggttcgggttcggcgcggaggacgtgtggacactgttccat
tcgttcgccttcgacttctcggtgtgggagctgttcggcgcgctgttgcatggcggccgg
ctggtggtggtgccgaagctgacggcgcgctcgccgcaggcgttctacgcgctgctgtgc
gaggccggggtgacggtgctgaaccagacgccgagcgcgttccgtcaactgatggcggcg
cagcaggaggcgccggcggcgcggcaccggctgcgccaggtgatcctgggcggggaagcg
ctggaggtgggcgcactgcgtccgtggtacgagcgcgccgagaacgccgggacgcaactg
gcgaacatgtacggcatcacggagaccacggtccacgtgagctaccgggcgctggaggcg
gctgatgcgcagggcacgggcagcccgatcggtcggcgtatcccggacctgcgggtgtac
gtgctggatgcgcacggcgagccggtgccggtgggggtgacaggggagatgtacatcggc
ggcgccggcgtggcacgcggttatctgaaccgcccggagctgacggcagagcgcttcgtg
gtgaacccgttccacggcgaaggccgtgagcggatgtacaggacaggggacctgggccgc
tggttgccggacggcagcctggagtaccagggccgagcggatgcacaggtcaagctgcgc
ggcttccggatcgagctgggcgagatcgaggcgagtctgtcgcagtgtgcgggcgtgcgg
gaagccgtggtgacggtgcgcgaggacgtgccgggcgagcagcggctggtggcgtactac
gtgagtggtgaggcaattgaagcccaggcgctgcgcgagcaactgcagggcagcttgccg
gcgtatatggtgccggctgcttacgtgaggctggcgcacttgccgctgacgtcgaacggc
aagttggaccgcaagggattgcccgcaccggaaggccacgcgtatgcgagcacggcctac
gaagcgccgcaaggcgaggtggagcagacgctggcaggcatctggcaaacgctgctgggc
gtggagcgcgtaggccgtcacgacgatttcttcgcactgggtggtcactcgctgcaggcc
gtacggctggtgacgcaggtacgcgtgcaactgggcgcggagcttggtctgacggcgctg
ttcgcccagccaagcctgagcgcggtggcacaagcgatcgtacgaggacagggcagcgca
ctgcaggcgatcacggcggccgaccgcagcgaggcgctgccgctgtcgttcgcgcagcaa
cggctgtggctgctggcccagatggaaggcggcagcgaggcgtaccacatcccggtaggc
cttcggctgaagggcgaactggacgaggatgcactaggtcgcgcgctggaccggatcgtg
gcgcggcatgaggcgttgcgcacgcgcttcgaggtgcgggaagggcaagcgatacagcgt
gtggcatcggcggacgtcggctttgcactggaccgggtggacctgcaaggacaggccgac
agggagcagacattggcggcgctgtcggagcgggaagccaataccccgttcgacctggag
caaggcccgctgatccggggctgcctggtgaagctgggcgagcaggaacacgtgctgctg
atcacgatgcaccacatcgtgtcggatggctggtcgcagggcgtgctggcgcgggagctg
ggcgcgctgtacgaggcctatcggtcgggcggcgaggacccgctgccggctttgccgatc
cagtacgcggactacgcagtctggcagcgccgatggctggagggcggggaactgcaaagg
cagggcgcgtattgggaacaagccttggccggtgccccgacgctgctgagcctgccgacg
gaccgggcacggccggcgcagcaggactacgcgggcggctcggtggaagtggtattcgac
gagacgctcagcgccgacctgaagcggctgagccagcgacacggaacaacgctgttcatg
acggtgctggcagggtggtcggcactgctgagccgcctgtcgggtcaggaggaagtggtg
gtgggctcgccggtggcgaaccgcacacgcagcgaggtcgagggcctgatcggcttcttc
gtgaacacgctggcactgagggtgaacgtcggcagcgcgacggtatcggagctgctggac
cgggtgaaggcaaaggtgctggaggcccaggcacatcaggacctgccgttcgagcaggtg
gtggagcgggtgaagccagtgcgcagcctgtcgcacagtccgatcttccaggccgtgttt
tcctggcacaacaccgaggcggtcgatctgtcgctgcgcgcgctgtcattggagagcctc
gcccgcgagaacgctacggcgaagctcgatatccagctggagctggcggaagcggacggg
cggatcgtgggcacgctcaactacgccaccgcattgttcgagcggtccaccgcgcagcgc
tatgcggactacctgcagcgcatgctccaagccatggtggccgacgacggccagcaggtg
gggcggatcgcgctgctcggcgaggcggagcgcgcgcaggtgctgcaggcctggaacgca
acggagcgtgcgtggccggcggcgacgctgccggccttgttcgaggcccaggtcatgcgc
acccccgacgccgtggcgctcaagcacgcagaccagcaggtgagctaccgcgagctggac
gcccgggccaaccgcctggcccatcatctacgggagctgggcgtggcggccgatgtgctg
gtggggctgtgcgtcgaccgttcgatcgagatgatcgtggggctgctgggtatcctcaag
gccggcggcgcgtatgtgccgctggacccggattatccgcaggcgcgcctggcctacatc
ttccaggacgcgatgctgtccgtgctggtcagcaagcgggcgctggcacagcggctgccg
atcgcctggacgcaggtcgtcgagctcgatgacgcggagccggcctgggccgactatccc
ccgacgccgccgcaggtccagggcgagccggggcagttggcctatgtgatctacacatcc
ggctcgaccggccagcccaagggcgtcgcggtcacccatcagggcgtggcgagcctggtg
tattcgcagtgcgagcgctttggtgtgagcagtcagtccagggtgctgcaatttgcctcg
atcagtttcgatgcggcggtctccgagatcggcatggggctgctctgcggcgcgtgcctg
gtgctggcgccggcgcaggcgttgatgcccggggccgcgttgacgcacctgctcgatcgc
gagcgcatcacccacgtcaccctgcccccggcggtgctggcgctgatgcccgaacaggcc
ctgccggcggactgccatctgatcgttgcgggcgaggcgtgcccgccgtcgctggtgcgc
ctctggtccgagggacgcaccatgatcaacgcttacggtccgaccgaggcaacggtctgc
gcgaccatgagccgagcgctgaccgctcaggacgcaccgtcgattggcgggccgatcggc
aacgttcgcgtctatgtcctggatgcctatctacagccggtgccggtgggggtgaccggc
gagctctatatcgcgggttcgggcctggcgcgcggctattggcagcgcgccggcctgacc
gccgagcggttcatggccaatccgtttgccttgggcgagcggatgtacaggacgggggac
cttgggcgctggttgccggacggcagcctggagtaccagggccgagcggatgcccaggtc
aagctgcgcggcttccggatcgagctgggcgagatcgaggcgaggctgtcgcagtgtgcg
ggggtcagcgaggcggtggtgacggtgcgcgaggatgcaccgggcgagcagcggctggtg
gcgtactacgtaagcggcgaggcaatcgaagcccagacgctgcgcgagcaactgcagagc
cgcttgccggaatacatggtgccggccgcctacgtgaggctggagcacctgccgctcacg
cccaacggcaagttggaccgcaaggggctgccggccccggagggccaagcctacgcgagc
acggcctacgaagcgccgcagggcgaggtggagcagacgctggcaggcatctggcaaacg
ctgctgggcgtggagcgtgtgggccgtcacgacgacttcttcgcgctgggcggccactca
ctacaagccgtgcggctggtggcgcaggtgcgcacgcagctgggcgcggagcttggtctg
acggagttgttcgcgcagccaagcctgagcgcggtggcgcaggcgatcgtgcggggacag
ggcagcgcgctgccggcgatcacggtggcggatcgcagtggaccgctgccgctatcgttc
tcgcagcagcggttgtggttcctggcgcagatggaagggggcagcgaggcgtatcacatc
ccggtaggccttaggctgaagggtgagctggatgaggatgcattgcgccgctcgctggac
cggatcgtggcgcggcacgaagcgctgcgcacgcgcttcgtaacggaggaagggcaagcg
gtacagcgcgtggcatcggcggacgttggctttgcactggactgtgtcgatctgcaagga
caggccgacagggagcaggcattggcgacgctatcggagcgggaagccaatacgccattc
gacctggcgcacggtccactgatccgaggccgcctggtgaagctgggcgagcaggaacac
gtcctgctgatcacgatgcaccacatcgtgtcggatggctggtcgcaaggggtgctggcg
cgggagctgggctcgctgtacgaggcctaccgtgcaggcaacgctgatccgctgccggcc
ttgccgatccagtacgcggactacgcagtctggcagcgccgctggctggagggcggggaa
ctgcaaaggcagggcacgtactgggaacaagcgctggccggcgccccaacgctgctgagc
ctgccgaccgatcgggcgcggccaccacagcaggactatgccggcggttcggtcgaagtg
gtattcgatgcggaactgagcaccgggcttaggacgctgagccagcggcatggaacaacg
ctgttcatgacggtgttggcaggttggtcggccctgctgagccgcctgtcgggccaggga
gaggtggtggtgggctcgccggtggcgaatcgcacgcgcagtgaggtggagggcctgatc
ggcttcttcgtgaacacgctggcactgagggtggaggtcggcggcgcgacggtatcggag
ctgctggagagggtgaaggcaaaggtgctggaagcccaggcccaccaggacctgccattc
gagcaggtcgtggagcgagtcaggccagtacgtagcctgtcgcacagcccggtgttccag
gccgcgctgtcgtggctgaacacggaagcggtcgggctgagtctggaactggagggtctg
acgatcgagggcgtggacgccggtcaggccgcagccaagttcgacctgacgctggaactg
agggaaacatcggaaggcctcgcgggctcgctggactatgcgacggcgctgttcgaccgg
gccaccatcgaacgctacctgggctacctgcaccggttgctcaaggcgatggccgccgac
gatagccaggaggtgaaccggatcgcgctgctggacgagggggagcgcacgcaactgctg
gagtcgtggaacgagacgaaggcgccgtacccgcgggcctcgacgatccacggtctgttc
gaggcccaggttcgccgcacgccggaagcgatcgcggtggtgcacgaaggccaacaggtg
agctacgcggaactgaacgcacgggcaaaccgtgtggcacatgcgctgaggcgtctgggc
gtaggcccggatgcccgagtgggtctgtgcgcggagcgaagcgtggaactggtggtcggg
ctgctggggatattgaaggcaggcggaggatacgtgccgctggacccgtcatatccgcag
gatcgtctgacctacatgctggaggacagcgccccggtggcagtgctgacgcagtcgaac
acacgcgagcagttgggggcactgtcggtgccagtgctggacctggatggaccgttggag
gaagccgaacacgatccgcaggtgacgggcctggaaccacaccacctggcctacgtgatc
tacacctcgggttccaccggccgccccaagggcgtgatgaacgagcaccgtggcgtcgtc
aaccggttgtggtgggcgcagcagacctatcgcctggatgccagcgaccgggtattgcag
aagacccctttcggcttcgatgtatcggtctgggaattgttctggcccctgctggcaggc
gcccgtctggtgatggcccggccggaaggccacaaggacccggcctatctggccgcgacg
atcgagcaggcggggatcaccacgttgcacttcgtgccatcgatgctgcaactgttcctg
gaccaggtggaggccgggcgttgccagggcttgcgccgcatgctgtgcagcggcgaggcc
ttgtcgcatgccttgcagcagcgcagcctggcgcgcttcccgcactcggaactgcataac
ctgtacggcccgaccgaggcggccatcgatgtcaccgcctggcgatgcaacgcagagatc
catccgggcgtcgtaccgatcggccggccgatcgcgaacacgcagatgtacgttctggat
gggcatcagcagccggtgccgttgggggtgaccggtgagatctatatcggcggcatcggc
gtcgcgcgcggctatctgaaccgtccggagctgacggcggagcgctttgttgtgaaccca
ttccacggcgaaggccgcgaacggatgtaccggacgggagaccttgggcgctggttgccg
gacggcagtctggcgtaccagggtcgggcggatgcccaggtcaagctgcgcggcttccgg
atcgaactgggcgagatcgaggcaaggctgtcgcagtgcgccggggtaagcgaggcggtg
gtggcgatgcgcgaggacgtgccgggcgagcagcggctggtggcgtaccacgtaagcgac
gaggcaatcgaagcccagacgctgcgcgagcagttgcaggccagcctgccggagtacatg
gtgccggccgcctacgtgaggctggagcacctgccgctgacgccgaacggcaagctggat
cgcaagggcttgccggccccagacggccaagcgtatgcgagcgcggcctacgaagcgccg
cagggcgaggtggagcagacgctggcaggcatctggcaaacgctgctgggcgtggagcgt
gtggggcgtcacgacgacttcttcgcgctgggcggtcactcgctgcaagccgtgcggctg
gtggcgcaggtgcgcacgcagctgggcgcggagctcgggctgacggaactgttcgcccag
ccaagcctgagcgcggtggcgcaggcgatcgtgcgaggacagggcaccgcactgccggcg
atcacggtggcggatcgcggcgaggcgctgccgctatcgttcgcgcagcagcgattgtgg
ttcctggcgcagatggaagggggcagcgaggcgtatcacatcccggtaggccttaggctg
aagggtgagctggatgaggatgcattgcgccgctcgctggaccggatcgtggcgcggcac
gaagcgctgcgcacgcgcttcgaggtgcaggaagggcaagcggtacagcgcgtggcatcg
gcagacgtggggttgacgctggactgggccgacctgagcgcggaggcagcatcagagcac
cagctcggcttgctggccgaggcgtgggcgagagccccgttcgacctggagcaaggccca
ctgatccgaggccgcctggtaaagctgggcgagcaggaacacgtcctgctgatcacgatg
caccacatcgtgtcggacgggtggtcgcagggcgtgctggctcgcgaattgggcgcactg
tacgaggcctaccgtgcaggtaactccgatccgctgccggccttgccgatccaatatgcg
gactacgcagtctggcagcgacgctggctggagggcggggaactgcaaaggcagggcacg
tactgggaacaagccttggccggcgcaccgacgctgctgagcgtgccgaccgaccgggcg
cggccaccacagcaggactacgcgggcggctcggtcgaagtgatattcgacgagacgctt
agcgcagggctgaggaagctgagtcagcgacacggaacgacattgttcatgacggtgctg
gccggttggtcggccctgctgagtcgcctgtctggccaggaagaggtggtggtgggctcg
ccggtagcgaaccgcacgcgcagcgaagtggagggcctgatcggcttcttcgtgaacacg
ctggcactgagagtggaagtcggcagcgcgacggtatcggagctgctgggccgagtgaag
tcacgggtgctggaagcccaggcccatcaggatctgccattcgagcaggtcgtggagcga
gtcaggccagtgcgcagcctgtcgcacagcccggtgttccaggcagcgctgtcgtggctg
aacacggaggcaatggtgctgaaactcgatgggctgaccatcgaacacctggccgacgag
agctacaccgcaaagttcgatctctccctggccttgcgcgagcacgacggccggatcgcg
ggctcgctggactacgcgacggcgctgttcgatcgggaaacgatcgaacgctacctgggc
tacctgcaccggttgctggcggcgatggtggagaacgacagccagcaggtgagccggatc
ggtctgctggacgagggcgagcgggcgcaactgctggagtcgtggaacgagacgaaggcc
gcctatccggatgcatcgacgatccacggcctgttcgaggcccaggttcgccgcacgccg
gaggcgatcgcggtagagcacgaaggccaacaggtgagctacgcggaactgaacgcacgg
gcaaaccgtgtggcacatgcgctgaggcgtctgggcgtaggtccggatgcccgagtgggt
ctgtgcgcggagcgaagcgtcgagctggtggtcgggctgctgggaatcctgaaggcaggc
ggaggatacgtgccgctggacccgtcatatccgcaggatcgtctggcctacatgctggag
gacagcgccccggtggccgtgctggcgcagtcgaacacacgcgagcagttgggggcactg
tcggtgccggtgttggacctggatagaccgctgttggaggaagccgaacacgatccgcag
gtgacgggcctggaaccacaccacctggcctacgtgatctacacctcgggctccaccggc
cgccccaagggcgtgatggtcgaacaccgtggcttgagcaatttgctggactggtacctg
gaggacttggggctgcgcagcgacgacaccgtgctgctggtctcctcatacagcttcgat
ctcacccagaagaacatcctggggccgctgctggcgggcgggcgcctgcatctggccggg
ccgttcgtgcctgatgcgctggtcgcgcagatccgtcgcgagggcatcacccatatcaac
ctgtcgcccagtgccttccatgccttgatcgacgccgccggcgcggaggggctgggcggg
ttgcggcgggtggtgctgggcggggagccgatccagccggccaggttgcagggcttgccg
gagcccaggccgcgcttcatcaacagctatggccccaccgagtgcagcgacgtggtggcg
tggcacgcgctcgatgccgaactcgatcgctaccgcgccgcgagcgttccgctgggccgt
tccgtgcgcaacgtgaggctgtacgtgctggacgcgcatcgtcagccggtccccaccggc
gtggccggagaaatctacgtcggcggcgcgggcgtggggcgcggctatcgaaacctgccg
gagctgaccggggcctgcttcctggccgatccgttccacggcgaaggccaggcgcggatg
tacaagaccggcgatctgggccgctggctcgcgaacggcagcctggagtacctgggccgc
agcgacgaccaagtgaagctgcgcggcttccgcgtcgagctgggtgaaatcggcgccagc
ctggcgcgctgcgacggcgtgcgcgaagcggccgtgctggcccgggaggatgctcccggc
gaaccgcgcctggttgcgtattacgtcgccgagcccggtgccgcggtggaggcttcggca
ttgcgccggcacatgcaggcgcagttgccggagcacatggtgccggctgcctacgtgagg
ctggagcacctgccgctcacgcccaacggcaagctcgaccgccgtgccttgcccgcaccc
gccgccgatgcctacgcgcgccgccgctacgtggcgccgcaaggcgacgtggagacgatg
ctggccgaactctggcaagacctgctcggcgtggagcgcgtgggccgccacgacgacttt
ttcgaactgggtggccattcgctgctggcgatgagcctgatggcgcggatggacgagctt
ggcttatccgccgacgtgcgcgtgttgttcacccagccgaccttggcgggcctggctgcg
gaagtggaaccgatggagattgtgctgtga

DBGET integrated database retrieval system