KEGG   Rhodobacter sphaeroides 2.4.1: RSP_0965Help
Entry
RSP_0965          CDS       T00284                                 

Gene name
sucA
Definition
(RefSeq) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00020  Citrate cycle (TCA cycle)
rsp00310  Lysine degradation
rsp00380  Tryptophan metabolism
rsp01100  Metabolic pathways
rsp01110  Biosynthesis of secondary metabolites
rsp01120  Microbial metabolism in diverse environments
rsp01130  Biosynthesis of antibiotics
rsp01200  Carbon metabolism
Module
rsp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSP_0965 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    RSP_0965 (sucA)
   00380 Tryptophan metabolism
    RSP_0965 (sucA)
Enzymes [BR:rsp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     RSP_0965 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 3720756
NCBI-ProteinID: YP_354049
UniProt: Q3IZ86
LinkDB All DBs
Position
1:complement(2724754..2727732)
Genome map
AA seq 992 aa AA seqDB search
MSGAAMTEQSPNAQFHASSFLQGQNAEYIDQLQARYAEDPASVDAGWAELFRSLGDSELD
AKRQAHGPSWSRPDWPPMPADDLTAALTGEWPAAPAKEAKAAGQKIQAKAAEQGVSLSDA
QVQRAVLDSIRALMIIRAYRIRGHLAADLDPLGLRNTTNHPELDPKSYGFTDADMDRPIF
IDNVLGLQVASMRQIVDIVKRTYCGTFALQYMHISDPEQAAWLKERIEGYGKEIHFTREG
RRAILNKLVEAEGFEKFLHVKYMGTKRFGLDGGEALIPAMEQIIKRGGALGVKEIVVGMP
HRGRLSVLANVMAKPYRAIFNEFQGGSFKPEEVDGSGDVKYHLGASSDRDFDGNTVHLSL
TANPSHLEAVNPVVLGKVRAKQEQAGDKTRHTVLPILLHGDAAFAGQGVVAECFGLSGLV
GHRTGGTIHIVVNNQIGFTTAPSFSRSSPYPTDIALMVEAPIFHVNGDDPEAVVHAAKVA
TEFRQKFHKDVVIDIFCYRRFGHNEGDEPMFTNPSMYTSIKKHKTTLQLYTERLVRDGLI
PEGEIEDMKAAFQAKLNEEFEAGKDFKPNKADWLDGRWKHIDRHGDEYQPGRTSISAETL
QEIGQALTRVPEGFDLHKTVGRQLEAKKQMFETGRGFDWATGEALAFGSFVVEGYPVRLS
GQDCTRGTFSQRHSAFINQSTEERYYPLNNIRSGQARYEVIDSMLSEYAVLGFEYGYSLA
EPNALVMWEAQFGDFANGAQIMFDQFINSGESKWLRMSGLVVLLPHGFEGQGPEHSSARL
ERFLQMSANDNWIVANCSTPANYFHILRRQIHRNFRKPLILMTPKSLLRHPLCISNAEDF
TTGSGFHRVLWDDAQKGHSETVLKPDEQIRRVVMCSGKVYYDLLAERDKRGIDDVYLMRL
EQFYPFPALSLVKELGRFKNAQIVWCQEEPKNQGGWTFVEPNLEWVLTRIGASHTRAIYA
GRSASASPATGLASRHKAEQDALVNDALTIGS
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggtgcagccatgacggaacagtctccgaacgcgcagttccatgcctcgagtttc
ctccaggggcagaatgccgagtatattgaccagttgcaggcacgttatgccgaagacccc
gcctccgtcgatgcgggctgggcggagttgttccgttcgctgggcgacagcgagctcgac
gccaagcgtcaggcgcatggcccctcctggtcgcggccggactggccgccgatgccggcg
gacgacctgaccgccgcgctgaccggcgaatggcccgccgctcctgccaaggaggcgaag
gctgccgggcagaagattcaggccaaggccgccgaacagggcgtgagtctcagcgacgct
caggtgcagcgcgccgtgctcgattcgatccgggcgctgatgattatccgggcctaccgg
atccgcggccacctcgccgccgatctcgatccgctcgggctgcgcaacaccacgaaccac
cccgagctcgacccgaagtcctacggctttaccgatgccgacatggaccggccgatcttc
atcgacaatgtgctcggtcttcaggtcgcttccatgcggcagatcgtggatatcgtcaag
cgcacctactgcggcacttttgcgctgcaatacatgcatatttccgaccccgaacaggcg
gcctggctcaaggagcgcatcgagggctacggcaaggagatccacttcacccgcgagggc
cggcgtgcgatcctgaacaagctggtcgaggccgagggcttcgagaagttcctccatgtc
aagtacatgggcaccaagcgcttcggtctcgacggcggcgaggcgctcatccccgccatg
gagcagatcatcaagcgcggcggcgcgctcggcgtgaaggagatcgtggtgggcatgccg
caccgcggccgcctctcggtgctggccaacgtgatggccaagccctaccgcgccatcttc
aacgaatttcagggcggcagcttcaagccggaagaggtcgacggctcgggcgacgtaaaa
tatcacctcggcgcctcctctgaccgtgacttcgacggcaacaccgtccacctgtcgctg
accgcgaacccctcgcacctcgaggcggtgaacccggtcgtgctgggcaaggtccgcgcc
aagcaggagcaggccggcgacaagacgcgccacacggtcctgccgatcctgctgcacggc
gacgcggccttcgcggggcagggcgtcgtggccgaatgtttcggcctgtcgggcctcgtc
ggtcaccgcaccggcggcacgatccatatcgtggtgaacaaccagatcggcttcaccacc
gcgccttccttctcgcgctcctcgccctatccgaccgacatcgcgctgatggtcgaggca
ccgatcttccatgtgaacggcgacgatcccgaggcggtggtccatgccgccaaggtggcg
accgagttccggcagaagttccacaaggatgtcgtcatcgacatcttctgctaccgccgc
ttcggccacaacgagggggatgaaccgatgttcaccaacccctcgatgtatacctcgatc
aagaagcacaagacgacgctccagctttataccgagcgtctggtgcgcgacgggctgatc
cccgagggcgagatcgaggacatgaaggccgccttccaggccaagctcaacgaggagttc
gaggccggcaaggacttcaagcccaacaaggccgactggctcgacgggcgctggaagcac
atcgaccggcacggcgacgaatatcagccgggccgcacctcgatctcggccgagaccctg
caggagatcggtcaggcgctgacgcgcgtgcccgagggcttcgacctgcacaagaccgtc
gggcgccagctcgaggccaagaagcagatgttcgagaccggccgcggcttcgactgggcg
acgggcgaggctctggccttcggctcgttcgtggtcgagggctatccggtgcgcctctcg
gggcaggactgcacccgcggcaccttcagccagcggcattcggccttcatcaaccagtcg
accgaggaacgctactacccgctgaacaacatccggtcgggtcaggcgcgctacgaggtc
atcgactcgatgctgtcggaatatgccgtgctcgggttcgaatacggctactcgctggcc
gagcccaatgcgctggtgatgtgggaggcccagttcggcgatttcgccaacggcgcccag
atcatgttcgaccagttcatcaactcgggcgaatcgaagtggctgcgcatgtcgggcctc
gtcgtcctgctgccgcacggcttcgaggggcagggccccgagcactcctcggcccggctc
gagcggttcctccagatgtcggccaacgacaactggatcgtggccaactgctcgacgccc
gcgaactacttccacatcctgcggcggcagatccaccggaacttccgcaagccgctgatc
ctgatgacgccgaagtcgctgctgcgccatccgctctgcatctcgaacgccgaggatttc
accaccggctcgggcttccaccgggtgctgtgggacgatgcgcagaagggccactcggaa
acggtgctgaagcccgacgagcagatccgccgtgtcgtcatgtgctcgggcaaggtctac
tacgacctcctcgccgagcgcgacaagcggggcatcgacgatgtctacctgatgcgtctc
gagcagttctatcccttcccggcgctgagcctcgtgaaggaactgggccgcttcaagaat
gcccagatcgtctggtgccaggaggaacccaagaaccagggcggctggaccttcgtcgag
ccgaacctcgaatgggtgctgacgcggatcggcgccagccacacgcgcgccatctatgcc
ggccggtcggcctcggcctcgcccgccacgggtctcgccagccgccacaaggccgagcag
gacgcgctggtgaatgacgcgctgacgatcgggagctga

DBGET integrated database retrieval system