KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109434985Help
Entry
109434985         CDS       T04863                                 

Gene name
NSD2
Definition
(RefSeq) histone-lysine N-methyltransferase NSD2 isoform X1
  KO
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
Lysine degradation
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rss00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109434985 (NSD2)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    109434985 (NSD2)
Enzymes [BR:rss01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109434985 (NSD2)
Chromosome [BR:rss03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109434985 (NSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1393 aa AA seqDB search
MEVSVRKGPLSVPKAVKCMRMKQAPELLGSASGKPASCDMNRECSVFLGKAQLSASLQDG
VMHKFNGHEALPFLPAEKLKLKDLTSRVFNGEPGAHDAKLRFESPEVKGGMGTPPNATPV
KNGSPEIKLKITKTYMNGKPLFESSICGDGAAAVSQLEENGQKAENKARRNRKRSIKYDS
LLEQGLVEAALVSRTSSPAERKIPAKKESRPSTGRDQDHLLKYNVGDLVWSKVSGYPWWP
CMVSADPLLHSYTKLKGQKKSARQYHVQFFGDAPERAWIFEKSLVAFEGEGQFEKLCQES
AKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKANFTFLYVGDQLHLNP
HAAKEAGVAVQSLGAMVGSSGFTEEAAENHKPVREGGVPIKRRRRAKLWRSAESQDSEPG
TAKTTPQKRAEADPKRGVGSPPGRKKAAASTPRSRKGDAASQFLVFCQKHREEVVAEHPD
ASGEEIEELLGSQWDMLSEKQKARYHTKFALVASAQPEEDSGSSLKSFGEAKRKVFQDSP
GRRPRPGSNLNGKKRTHTKRTQDPTGDAEGEDAPRKRLRTDKHGLWKREMITDKTARTSS
YKAMEAATSLKTQAATKHLSDACKPLKKRSRASAAASSALAFSKSSSPSASLTENEVSDG
AGDEPLESPYESADETQTEVSVSSKKSERGVTAKKEHVCQLCEKTGSLLLCEGPCCGAFH
LACLGLARRPEGRFTCSECSSGVHSCFVCKESKADVKRCVVSQCGKFYHEACVRKFPLTV
FESRGFRCPLHSCASCHAANPSNPRPAKGKMMRCVRCPVAYHGGDACLAAGCSVLASHSI
ICPGHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCND
CRAGKKLHFQDIVWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEVGEFPVFFFGSKDYYWT
HQARVFPYMEGDRGSRYQGVRGIGRVFKNALQEAEARFREIKLQREARETQESERKPPPY
KHIKVNKPYGKVQIYTADISEIPKCNCKATDESPCGFDSECLNRMLMFECHPQVCPAGEF
CQNQCFTKRQYPETKIIRTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIRHAHE
NDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPA
GTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSASLSAEEKGKKAKKKSRRRRAR
GEGKRSEDECFRCGDGGQLVLCDRRSCTKAYHLPCLGLGKRPFGKWECPWHHCDVCGKPS
ASFCHFCPNSFCKEHQDGTVFSCTQDGRSYCCEHDLGTESIRSAKAEKPFPEPTKSKGKR
KRRRCWRRVTEGK
NT seq 4182 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcagcgtcagaaaaggtcccctttctgtcccaaaagctgtcaagtgcatgagg
atgaagcaggccccggagctgctgggcagcgccagtgggaagcctgccagctgcgacatg
aaccgcgagtgctctgtgttcctggggaaggcccagctgtccgccagcctgcaggatggg
gtcatgcacaagttcaacggccacgaggcactgccctttcttcctgcggagaagctaaag
ctgaaagacctcacttcccgcgtgttcaatggggagcccggtgctcacgatgccaagctg
cgttttgagtccccagaggtgaagggggggatggggaccccgccgaatgccacccctgtc
aaaaatggctctccggagattaagctgaaaatcaccaaaacgtatatgaatgggaaacct
ctcttcgaatcttccatttgtggcgatggtgctgctgctgtgtcccagttggaagaaaat
ggacaaaaagcagaaaacaaggcgaggaggaacaggaagaggagcataaaatacgactcg
ttgctggagcagggccttgtcgaagcagctctggtgtctaggacgtcaagtcccgcagag
agaaagattccagctaagaaagagtcccgtccaagtaccggccgagaccaagaccaccta
ttgaaatacaatgtcggcgatttggtgtggtccaaagtgtccgggtacccctggtggcca
tgcatggtttctgccgaccccctgctgcacagctacaccaaactcaaaggtcagaaaaag
agtgcacgccagtatcacgtacagttctttggtgatgccccagaaagagcttggatattt
gagaagagccttgtagcttttgaaggagaaggacagtttgaaaaattatgccaggaaagt
gccaagcaggcacccacgaaagctgagaaaattaagctgttgaaacctatttcagggaaa
ttgagggcccagtgggaaatgggcatcgttcaagcagaagaagctgcaagcatgtcagta
gaggagcggaaagccaacttcacgttcctctacgtgggggaccagcttcacctgaaccct
catgcagctaaggaggccggcgttgctgtgcagtctctgggggccatggtggggtcctcg
gggttcactgaagaagctgctgagaaccacaagcccgtgagagaagggggcgtgcccatc
aagagaaggcggagagccaagctgtggcgctctgctgagagccaagacagtgagcccggg
acagcgaagacgactcctcagaagcgggcagaggctgatcccaagagaggagtcgggtct
cctcctgggaggaaaaaggccgcggcctccacgccacggagcaggaagggggatgcggca
tcccagttcctggtcttctgtcagaagcacagggaagaggtcgtagccgaacacccagat
gcctctggcgaggagattgaagagctgctggggtcccagtgggatatgctcagcgagaag
cagaaagcgcgctatcacaccaagtttgccctggtggcctccgcccagcctgaggaagac
tctggttcatcactgaagagttttggagaggccaaacgtaaagtgtttcaagactcacct
ggaaggagaccgagacccggaagtaacttaaatgggaaaaaaagaacccacacaaagagg
acacaggaccccactggagacgctgaaggtgaggatgcgcccaggaaaagactccggacg
gacaagcacggtctttggaagagagagatgatcactgacaaaacagcccggacaagctct
tacaaggccatggaggcagccacctccctgaagacccaggcagcaacgaaacatctgtct
gacgcgtgcaaaccactgaagaagcgaagccgggcatccgcggcagcgtcctcagctctt
gcgttcagcaagagctcctctccttccgcatccttaactgagaacgaggtctcggacggt
gcgggagacgagcccttggagtccccgtatgaaagtgcagacgaaacacagaccgaagtg
tccgtctcatcaaaaaagtctgaacgaggagtaactgccaaaaaggagcacgtatgtcag
ctgtgcgagaagactggcagcctgctgttgtgcgagggcccctgctgcggcgccttccac
ctggcctgcctcggcctcgcccggagacccgaagggcggttcacctgcagcgagtgctct
tcaggggttcactcgtgcttcgtgtgcaaggagagcaaggcagatgtgaagcgctgtgtc
gtgtcgcagtgtgggaagttctaccacgaggcgtgtgtgaggaagttccccctgacggtg
ttcgaaagccggggcttccgctgcccgctgcacagctgtgccagctgccacgccgccaac
ccgtccaacccgcggccagccaaaggtaaaatgatgcgttgtgttcgctgcccggtcgcc
tatcacggaggggacgcctgtctggcagcgggctgctcggtgctggcttcccacagcatc
atctgcccgggccacttcacggcccggaaggggaagaggcaccacgcccatgtcaacgtc
agctggtgctttgtgtgctccaaagggggcagcctgctgtgctgcgagtcctgccccgcc
gccttccaccccgactgcctgaacatcgagatgccggatggcagctggttctgcaacgac
tgccgggccggcaagaagctgcacttccaggacatcgtgtgggttaagctcgggaactac
agatggtggccggcagaagtttgccatcccaaaaatgttcccccaaatattcagaaaatg
aagcacgaggttggagaattccctgtgtttttctttgggtctaaagattattactggacg
catcaggcgcgagtgttcccgtacatggagggggaccggggcagccgctaccagggcgtc
agaggaatcggcagagtcttcaaaaacgcactgcaagaagctgaagctcgttttcgtgaa
atcaaacttcaaagggaggccagagaaacgcaggagagcgagcgcaaacccccgccatac
aagcacatcaaggtgaacaagccttacgggaaagtgcagatctacacggctgacatttcc
gagatccccaagtgcaactgcaaggccacggacgagagcccgtgcggcttcgactcggag
tgtttgaacaggatgctgatgtttgagtgccacccgcaggtgtgccctgccggggagttc
tgccagaaccagtgcttcaccaagcgccagtaccctgagaccaagatcatcaggacagac
ggcaagggatggggcctggtcgccaagagggacatcagaaagggcgagttcgtgaacgag
tacgtgggcgagctgatcgacgaggaggagtgcatggcgcgcatcaggcatgcgcacgag
aacgacatcacccacttctacatgctcaccatcgacaaggaccgtataattgacgctggc
cccaaaggcaactactcccgatttatgaatcacagctgccagcccaactgcgagaccctc
aagtggacagtgaatggcgacactcgagtgggcctctttgctgtgtgtgacattcccgca
gggacagagctgactttcaactacaacctcgactgtctggggaacgagaaaacagtctgc
cgctgtggggcctccaactgcagtggattcctaggggacagaccgaagacgtccgcgtcc
ctgtctgcagaggaaaaggggaaaaaggccaagaagaagagccggcgtcgcagagcgaga
ggcgaggggaagcggtcggaggacgagtgcttccgctgtggcgacggcggccagctggtg
ctgtgcgaccgcaggtcctgcactaaggcctaccacctgccctgcctgggcctgggcaag
cggcccttcgggaagtgggaatgtccctggcatcactgtgacgtgtgcggcaaaccttct
gcttctttttgccacttttgccccaactcgttttgcaaggaacaccaagacgggacagtc
ttcagctgtacccaggatgggcggtcctactgctgtgagcatgacttggggacagagtcc
attagaagtgccaaggctgaaaagccctttccagaacccacgaagtccaaggggaagagg
aagaggaggagatgttggcggagagtcaccgaaggcaaatag

DBGET integrated database retrieval system