KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109436074Help
Entry
109436074         CDS       T04863                                 

Gene name
SUV39H1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1 isoform X1
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:rss00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109436074 (SUV39H1)
Enzymes [BR:rss01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109436074 (SUV39H1)
Chromosome [BR:rss03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109436074 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    109436074 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 412 aa AA seqDB search
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNFYDFEVEYLCDYKKIREQEYY
LVKWRGYPESESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKPPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRNHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPVGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCSCGYECPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaaggctgtagtgtgtgttgcaagtcttcttggaatcagctacag
gacctgtgccgtttggccaagctctcctgccctgctctcggcatctccaagaggaatttc
tatgactttgaagtcgagtacctgtgcgattacaagaagatccgcgaacaggagtattac
ctggtaaaatggcgtggctacccagagtcagagagcacctgggagccacggcagaacctc
aagtgtgtgcgcattctcaagcagttccacaaggacttagaacgagagctgctccggcgg
caccaccggtcaaagccaccccggcacctggacccaagcttggccaactacctggtgcaa
aaggccaagcagaggcgggcgctccggcgctgggagcaggagctcaatgccaagcgcaac
cacctgggacgcatcaccgtggagaatgaggtggacctggatggccccccacgggccttt
gtgtacatcaacgagtaccgtgttggggagggcatcaccctcaaccaggtggccgtgggc
tgcgagtgccaggactgtctgtgggcacctgttggaggctgctgccctggggcatcgctg
cataagtttgcctacaatgaccagggccaggtgcggctgcgagccgggctgcccatctac
gagtgcaactcccgctgcagctgcgggtatgaatgccccaaccgcgtggtgcagaagggc
atccgctacgacctctgcatcttccgcacggatgatgggcgtggctggggcgtccgcacg
ctggagaagatccgcaagaacagcttcgtcatggagtacgtgggagagatcattacctca
gaggaggcggagcgtcggggtcagatctacgaccgccagggcgccacatacctcttcgat
ctggactacgtggaggacgtgtataccgtggatgccgcctattatggcaacatctcccac
tttgtcaaccacagttgtgaccccaacctccaggtgtacaacgtcttcatagacaacctt
gatgagcggcttccccgcatcgctttctttgccacaagaaccatccgggcaggcgaggag
ctcacatttgattacaatatgcaagtggaccccgtggacatggagagcacccgcatggac
tccaactttggcctggccgggctccccggctcccccaagaagcgggtccgtattgaatgc
aagtgtgggactgaatcctgccgcaaatacctcttctag

DBGET integrated database retrieval system