KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109436132Help
Entry
109436132         CDS       T04863                                 

Gene name
TGM1
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Brite
Enzymes [BR:rss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     109436132 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 810 aa AA seqDB search
MMDGPRSDMGRWSGSPWQPPATPSPEPEPEPDRRSRRGGRSFWARCCACCSCRSGADDDW
GPESGSRDRGGRRPDRGSDSRRPISRGSGVNAAGDGTIREGMLVVTGVDLLSLRSDQNRR
EHHTDEFEYDELILRRGQPFHMVLYLSRPYESSDRVTLELHIGNNPEVGKGTHVIIPVGK
GGSGGWRAQVTKSSGQNLNLRVHTSPNAIIGKFQFTVRTHSDAGEFLLPFDPHNEIYILF
NPWCSEDIVYVDREDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDACLYILDR
RGMPYGGRGDPVSVSRVVSAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVEILLSYLR
TGYSVPYGQCWVFAGVTTTVLRCLGLATRTITNFNSAHDTDTSLTMDIYFDENMKPLEHL
NHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESIKNGLVYM
KYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIITKAIGSNMREEVTHIYKHP
EGSEAERKAVETATAHGSKPNVYATRDSTEDVAVQVETQDAVMGQDLTVSVVLTNRGSSR
RTVKLHLYLSVTFYTGVTGPVFKENKKEVVLAPGASDRVTMPVAYKEYQPHLVDQGAMLL
NVSGHVKENGQVLAKQHTFRLRTPDLSLTLLGAAMVGQECEVQIVFKNPLPVTLTNVVFR
LEGSGLQRPKILNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVA
PASGGRGVFSDAGADGPSGENIPMASRGGA
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgatggatggtccacgttcagacatgggccgctggagtgggagcccctggcagccccct
gccacaccttccccagagccagagccggagccagacagacggtctcgtcgtgggggacgt
tctttctgggctcgctgctgtgcctgctgctcctgccggagtggggcagatgatgactgg
gggcctgagtctggctccagggatcgagggggccgaagacccgaccgtggctcagactcc
cgccggcctatttcccggggcagtggtgtgaatgcagccggagatggcaccatccgagag
ggcatgctggtggtgaccggtgtggatctgctgagtttacgctcagatcagaaccgccga
gagcatcacacagatgagttcgagtatgacgaactgatcctgcgccgtgggcagcctttc
cacatggtcctctacctgtctcggccctatgagtcctccgatcgtgtgaccctggaactg
cacattggaaacaaccctgaggtgggcaagggcacccatgtgatcatcccagtgggcaag
gggggcagtggaggctggagggcccaggtgaccaagtccagtggacagaatctgaaccta
cgggtccacacctcccccaatgccatcatcggcaagtttcagttcacggtccgcacacac
tcagacgctggcgagttcctgttgcccttcgacccccacaatgagatctacatcctcttc
aatccctggtgctcagaggacatcgtatacgtggaccgtgaggattggcggcaggagtac
gtgcttaatgagtctgggagaatttactacgggactgaagcacagattggcgagcgaacc
tggaactacggccagtttgaccacggggtgctggatgcctgcctgtacatcctggaccgg
cggggcatgccatacggaggccgtggggacccagtcagtgtctcccgggtcgtctctgcc
atggtgaactccctggatgacaatggggtcctgattgggaactggtctggcgattactcc
cgaggcaccaacccatcagcgtgggtgggcagcgtggagatcctactcagctacctacgc
actggctattctgtcccctatggccagtgctgggtcttcgccggtgtgaccaccacagtg
ctgcgctgcctgggcctggctacccgtaccatcaccaacttcaattctgcacatgacaca
gacacgtccctcaccatggacatctactttgatgagaacatgaagcctctggaacacctg
aaccatgattctgtttggaacttccacgtgtggaatgactgttggatgaagaggccggat
ctgccctctggctttgatggatggcaggttgtggacgccacaccccaggagaccagcagt
ggcatcttctgctgtggcccctgctccgtggagtccatcaagaatggcctggtctacatg
aagtatgatacacccttcatttttgccgaggtgaacagtgacaaggtttactggcagcgg
caggacgacggcagcttcaagattgtgtatgtggaggagaaggccattggcacactcatc
atcacaaaggccattggctccaacatgcgggaggaggtcacccacatctataagcaccca
gaaggctcagaagcagaacgcaaggccgtggagacagcaaccgcccatggcagcaaaccc
aatgtgtatgccacccgggactccactgaggacgtggcagtgcaggtggagacccaggat
gcagtgatggggcaggacctgacggtcagcgtggtgctaaccaatcgcggcagcagccgc
cgcactgtgaagctgcacctctacctctcagtcaccttctacactggcgtcacaggaccc
gtcttcaaggagaacaagaaagaagtggtgctggcgccaggggcctcggaccgtgtgacc
atgcctgtggcctacaaggaataccagccccatctcgtggaccagggggccatgctgctc
aacgtctcgggccacgtcaaggagaatgggcaggtgctggccaagcagcacaccttccgt
ctgcgcaccccggacctctccctcacgctgttgggagcagccatggttggccaggagtgc
gaagtacagattgtcttcaagaaccccctacctgtcaccctcaccaacgtcgtcttccgg
ctcgagggctccgggttacagagacccaagatcctcaatgttggggacattgggggcaac
gagacagtgacactgcgtcagacatttgtgcctgtgcgaccaggcccccgccagctcatc
gccagcttggacagcccacagctctcccaggtgcatggtgtcatccaggtggacgtggcc
cccgcctctgggggcaggggcgtcttctcagatgctggagctgacggtccctcaggagag
aacatccctatggcttctagagggggcgcttag

DBGET integrated database retrieval system