KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109437961Help
Entry
109437961         CDS       T04863                                 

Gene name
KMT5B
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B isoform X1
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:rss00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109437961 (KMT5B)
Enzymes [BR:rss01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109437961 (KMT5B)
Chromosome [BR:rss03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109437961 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 883 aa AA seqDB search
MKWLGESKNMVVNGRRNGGKLSNDHQQNQSKLQHTGKDTVKAGKNAVERRSSRCNGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKSDSFP
HNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKNNATSSRKSSVGVKKTSKSRTLTRQSMSRIPA
SSNSTSSKLTHINNSRVPKKLKKPAKPLLSKIKLRNHCKRLEPKSASRKLEMGNLVLKEP
KVVLYKNLPIKKEKEPEGPVQATMASGCLTRHAAREHRQSFGRGVSPRGEAAPGTYTTRR
SMRTRMNLKETSDIKLEPNTPDGYKNSLSEPCPDSGEQPSPVTQQEDLAHETAQKGEAEC
PKSDSSIAKKKSRQGKLVKQLAKAEESTLLHDVPGQAGGVPDVTGSHPDPDEHSGMEGVA
GSYVDWAPSPVDGSVVTSDGFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTLRR
RHDSSSKTNDQENDGMNSSKISIKLSKDHENDNNLYVAKLNNGFNSGSGSSSTKLKIQLK
RDEESRGPYADGLHENGVCCSDPLALLGSQMEVDDYSQYEEESTDGPSSSDGDAEEDEYD
DDFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagaatccaagaacatggtggtgaatggcaggagaaatggaggcaag
ttgtctaatgaccatcagcagaatcaatcaaaattacagcacacggggaaggacaccgtg
aaggcgggcaaaaacgcagtcgagaggaggtcaagccgctgtaatggtaattcaggattc
gaaggacagagtcgatatgtaccatcttctggaatgtctgccaaggagctctgtgaaaac
gatgacctagcaaccagtttggttcttgatccctatttaggttttcaaacacacaaaatg
aatactagcgcctttccttcgaggagctcaaggcatttttcaaaatctgacagttttcct
cacaacaaccctgtgagatttcgacctattaaaggaaggcaagaagaactaaaggaagta
attgaacgttttaagaaagatgagcacttggaaaaagccttcaaatgtttgacttcaggc
gaatgggcgcggcactattttctgaacaagaacaaaatgcaggagaaattattcaaggaa
catgtgttcatttacttgcgaatgtttgcaactgatagtggatttgaaatattgccttgt
aatagatactcatcagaacaaaatggagccaagatagttgcaacgaaagagtggaaacga
aatgacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggagaac
atgctacttagacatggagaaaacgacttcagtgtcatgtattccacaaggaaaaactgt
gctcagctctggcttggtcccgctgcatttataaaccatgattgcagacctaactgtaag
tttgtgtcaactggtcgcgatacagcgtgtgtgaaggctctaagagatattgaacctgga
gaagaaatttcttgttactatggagatgggttttttggagaaaataatgagttctgcgag
tgttacacttgtgaaagacggggaactggtgcttttaaatccagagtgggactgcctgcg
cctgctcctgttatcaatagcaaatatggactcagagaaacagataaacgtttaaatagg
cttaaaaagttaggtgacagcagcaaaaattcagacagtcaatctgtcagctctaacact
gacgctgataccactcaggaaaaaaacaatgcaacttctagccgaaaatcttcagttggt
gtgaaaaagaccagcaagagcagaacattaactaggcaatctatgtcaagaattccagct
tcttccaactctacctcatctaaactaactcatataaataattccagggtaccaaagaaa
ctgaaaaagcctgcaaagcctttactctctaagataaaattaagaaatcattgcaaacgg
ctggagccgaagagtgcttcgagaaaacttgagatgggaaacttagtacttaaagagcct
aaagtagttctgtataaaaatttgcccattaaaaaagaaaaggagccagagggaccagta
caagccaccatggctagtgggtgcttaacgagacatgcagcgcgagagcacaggcagagc
tttgggcgaggcgtctccccgcgcggggaggccgctcccggcacgtacaccaccagacgg
tccatgcggacgagaatgaatttgaaggagacctctgacatcaagcttgaaccaaatacg
ccggatggctataaaaacagcttgtcggaaccttgcccagacagtggcgagcaaccatct
cctgtgacacagcaggaagacctggcgcatgaaactgcacaaaagggggaagcagagtgt
cctaagagtgacagcagcattgcaaaaaagaagtcacgccaaggaaaacttgtgaaacag
ttggcaaaagcagaggaatccactctcctgcatgatgtccccgggcaggccgggggggtg
ccagatgtgacgggatcccaccctgacccggacgagcacagtggcatggagggtgtggcc
ggcagctacgtggactgggccccttcacctgtggatgggtcagttgtgacgtcagacggc
ttcaaaacaaaagacagcttcagaactgcaaaaagtaaaaagaagaggcgaatcacaagg
tatgatgcacagttaatcctggaaaataactccgggatccccaaattgactctccgtagg
cgccatgatagcagcagcaagacaaatgaccaagagaatgatggaatgaattcttcaaaa
ataagcatcaagttaagtaaagaccatgaaaacgataacaatctctatgtagcaaagctt
aataatggatttaactcaggatcaggcagcagttctacgaaactaaaaatccagctaaag
cgggacgaggagagcaggggaccgtatgcagacggccttcatgaaaacggggtgtgctgt
agtgaccctcttgctctcctggggtcgcagatggaagtcgatgactacagtcagtatgag
gaggagagtacagacggcccgtcctcttcagacggagacgcggaagaggacgagtatgac
gatgactttgaagatgattttattcctctccctccagccaagcgcttgaggctcatcgtg
gggaaggactcgatagatattgacatttcttccaggagaagagaagatcagtctttgagg
cttaatgcataa

DBGET integrated database retrieval system