KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109445137Help
Entry
109445137         CDS       T04863                                 

Gene name
GPD2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rss00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    109445137 (GPD2)
Enzymes [BR:rss01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     109445137 (GPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 FAD_binding_2 EF-hand_6 GIDA FAD_oxidored EF-hand_8 Pyr_redox_2 EF-hand_5 EF-hand_9 HI0933_like EF-hand_10 NAD_binding_8 Pyr_redox_3 Pyr_redox FAD_binding_3 Thi4 EF-hand_4 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 109445137
NCBI-ProteinID: XP_019582733
LinkDB All DBs
Position
Unknown
AA seq 727 aa AA seqDB search
MAFKKAVKGTILAGGGALATVLGLSQFAHYRRKQMSLAYVEAAEYVSEPVNREPPSREAQ
LLTLQNTSEFDVLVIGGGATGCGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRMVKEALYERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWVGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNVAIALTAARYG
AATANYMEVMSLLKKTDPQTGKELVSGARCKDVLTGQEFDVRAKCVINATGPFTDTVRKM
DDKNATAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTD
ITHHPVPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNH
VVDISESGLITIAGGKWTTYRSMAEDTINAAIKAHNLKAGPSKTVGLFLQGGKDWSPTLY
IRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGKELNWDDHKKQEELETAKKFLY
YEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLENINIQMD
ENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLEGRVPIPV
DRSCGGL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcatttaaaaaggcagtgaaagggactattcttgctggaggaggtgcacttgctact
gttctaggcctctctcagtttgctcattacagaaggaagcaaatgagcctggcctatgtg
gaagcagcagagtacgtttcagaacctgtcaacagggagcctccttccagagaagctcag
ctactgactttgcaaaacacatctgaattcgatgtccttgtcattggaggaggagcaaca
ggatgtggctgtgcactagatgctgtcaccagaggactaaaaacagcccttgtagaaaga
gatgatttctcatcagggaccagcagcagaagcactaaattgatccatggtggtgtgaga
tatcttcagaaggctatcatgaagttggatattgagcagtataggatggtaaaagaagcc
ctttatgaacgtgccaacctattagaaattgctccccatttatcagctccgttacctata
atgcttccagtttacaagtggtggcagttaccttactactgggtaggaatcaagctatat
gatctggtagcaggaagtaattgcctgaaaagcagttatgtcctcagcaaatcgagagcc
cttgaacatttcccaatgctccagaaggacaaactggtaggagcaattgtctactatgat
ggacagcacaacgacgctcggatgaatgttgccattgcgctcactgctgccaggtatggg
gctgccacggccaattacatggaggtcatgagcttgctgaagaagacagacccccagaca
gggaaggagcttgtaagcggtgcacggtgcaaggatgtgctcacagggcaggaatttgat
gtgagagcaaaatgtgttatcaatgccacgggacctttcacagacactgtgcgcaaaatg
gatgataagaacgccacagctatctgccagccgagtgctggtgtgcacattgtgatgcct
ggttattacagcccagagagcatggggcttcttgacccagcgaccagtgatgggagagtt
attttcttcttaccctggcaaaagatgactatagctggcaccaccgacactccaactgat
attacacaccatcctgttccttcggaagaagacatcaatttcattttgaatgaagtgcgt
aactacctgagttgtgatgttgaagtgagaagaggggacgtcctggcagcctggagtggc
attcgtccgcttgttacagaccccaagtctgcagatactcagtccatctcccgaaatcat
gttgtggatatcagtgagagcggcctcatcactatagcaggtggaaagtggacaacctat
cgatctatggcagaagacaccataaatgctgcaatcaaggctcataatttgaaagcagga
ccaagtaaaacagttgggcttttccttcaagggggcaaagattggagtcccacactctac
attaggcttgtccaggattacggacttgaaagtgaggtggctcagcatcttgccgcaacc
tatggtgacaaggcttttgaggtggccaaaatggcaagtgtgactggaaaaaggtggccc
attgttggtgtgcgtcttgtgtcagaatttccatacattgaagcagaggtgaaatacgga
attaaggagtatgcctgcactgcagtggatatgatttcccgtcgcactcgcctggccttt
ctaaatgtccaggcagcagaggaagccctacccaggattgttgaactgatgggcaaagaa
ctgaattgggatgatcataaaaaacaggaagaacttgaaacagccaagaagtttctgtat
tatgaaatgggctacaaatctcgatcagaacagttaacagatcgctctgaaattagccta
ctgccttcagatattgacaggtataagaagagatttcataagtttgatgcagaccaaaag
ggctttattaccattgtcgatgttcagcgtgtattagagaatatcaatatccaaatggat
gaaaatacactgcatgaaattctgaatgaagtggatttgaacaaaaatggacaagttgaa
ctcaatgaatttttgcagctgatgagtgctattcaaaaaggaagggtgtctggcagccga
ctggcaatactaatgaaaacagcagaagagaacctggagggacgggttcccattccggtg
gaccgaagttgtggaggactgtga

DBGET integrated database retrieval system