KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109450625Help
Entry
109450625         CDS       T04863                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  
prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
Arachidonic acid metabolism
Metabolic pathways
NF-kappa B signaling pathway
VEGF signaling pathway
IL-17 signaling pathway
TNF signaling pathway
Retrograde endocannabinoid signaling
Serotonergic synapse
Ovarian steroidogenesis
Oxytocin signaling pathway
Regulation of lipolysis in adipocytes
Leishmaniasis
Human papillomavirus infection
Kaposi's sarcoma-associated herpesvirus infection
Pathways in cancer
Chemical carcinogenesis
MicroRNAs in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rss00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    109450625 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    109450625 (PTGS2)
   04064 NF-kappa B signaling pathway
    109450625 (PTGS2)
   04668 TNF signaling pathway
    109450625 (PTGS2)
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    109450625 (PTGS2)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    109450625 (PTGS2)
   04913 Ovarian Steroidogenesis
    109450625 (PTGS2)
   04921 Oxytocin signaling pathway
    109450625 (PTGS2)
  Nervous system
   04726 Serotonergic synapse
    109450625 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    109450625 (PTGS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    109450625 (PTGS2)
   05206 MicroRNAs in cancer
    109450625 (PTGS2)
   05204 Chemical carcinogenesis
    109450625 (PTGS2)
   05222 Small cell lung cancer
    109450625 (PTGS2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    109450625 (PTGS2)
   05165 Human papillomavirus infection
    109450625 (PTGS2)
   05140 Leishmaniasis
    109450625 (PTGS2)
Enzymes [BR:rss01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     109450625 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 605 aa AA seqDB search
MLARALLLLYATLALSCAGNPCCSNPCQNRGVCMSVGFDQYKCDCTRTGFYGENCTTPEF
LTRIKLFLKPTPNTVHYILTHFKGVWNIVNNIPFLRNAIMKYVLTSRSHLIDSPPTYNAQ
YGYKSWEAFSNISYYTRALPPVADDCPTPMGVKGKKELPDSKLIVEKFLLRRTFVPDPQG
TNLMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHIYGETLDRQHKLRLFKDGKMK
YQIIDGEMYPPTVKDTQAEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVC
DVLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQY
QNRIAAEFNTLYHWHPLLPDTFQIEDQEYNHRQFLYNNSMLMEHGLTQFVESFSRQIAGR
VAGGRNLPAAIQHVAKASIDQSRQMKYQSLNEYRKRFLMKPYESFEELTGEKEMAAELEA
LYGDIDAMELYPALLVEKPRTDAIFGETMVELGAPFSLKGLMGNPICSPNYWKPSTFGGE
VGFKIINTASIQSLICNNVQGCPSTSFSVQDPEPTKTVTINASPSHSGLDDINPTVLLKG
RSTEL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccttgctgctgctctacgccaccctggcgctcagctgtgcaggaaat
ccttgctgttccaacccatgtcaaaaccgaggtgtatgcatgagtgttggatttgaccag
tataagtgtgactgtacccggacaggattctatggtgaaaactgtacaacacctgaattt
ctgacaagaataaaattattcctgaaacccactccaaacacagtgcactatatacttacc
cacttcaagggagtctggaacattgtcaataatattcccttcctgcgaaatgcaattatg
aagtatgtgttgacatccagatcacatttgattgacagcccgccaacctacaatgcacag
tatggctataaaagctgggaagccttttctaatatctcctattataccagagctcttcct
cctgtggctgacgactgtcccactcccatgggcgtgaaaggaaagaaagagcttcctgat
tcaaaattgattgtggaaaaatttcttctaaggagaacgtttgtccctgacccccagggc
acaaatttgatgtttgcgttctttgcccagcacttcacccatcagtttttcaagacagat
cacaagcgaggaccagctttcaccaaaggactggggcatggggtggatttaaatcatatt
tatggtgaaactttggatagacagcataaactgcgccttttcaaggatggaaaaatgaaa
tatcagataattgatggagagatgtatcctcccacagtcaaagatactcaggcggagatg
atctatccccctcatgtccctgaacacctgcggtttgctgtggggcaggaggtgtttggt
ctggtgccgggtctgatgatgtatgccacgatttggctccgagaacataacagagtgtgt
gatgtgcttaaacaggagcatccagaatgggatgacgagcggttgttccagacaagcagg
ctgatactgataggagaaaccattaagatcgtgatagaagactacgtacagcacttgagt
ggctatcacttcaaactgaagtttgacccagagctgcttttcaaccaacaattccagtac
caaaaccgcattgctgctgagtttaacacgctctaccactggcatcccctcctgcctgac
acctttcagattgaagaccaggagtacaaccatcgacagtttctctacaacaactctatg
ttaatggaacatgggcttacccagtttgttgaatcattcagcaggcaaattgctggcagg
gttgctggtggcaggaatctcccagctgcaatacaacacgtagcaaaggcctccatcgac
cagagcagacagatgaagtatcagtctctgaatgagtaccgcaaacgctttctgatgaag
ccctatgaatcatttgaagaacttacaggagagaaggaaatggctgcagagttagaagcc
ctctatggggacatcgatgccatggagctgtatcctgcccttttggtagaaaagccacgc
acagatgccatctttggtgagaccatggtagaacttggcgcacctttctccttgaaagga
cttatgggcaatcctatatgttctcctaactactggaaaccgagcacttttggtggagaa
gtaggttttaaaatcatcaacactgcctcaatccagtctctcatctgcaataacgtgcaa
ggctgtccttctacttcattcagtgttcaagacccagaacccaccaagacagtgaccatc
aatgcaagcccttcccactctggactggatgatattaaccctacagtactactgaaagga
cgttcaactgaactgtag

DBGET integrated database retrieval system