KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109453901Help
Entry
109453901         CDS       T04863                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  
transmembrane protease serine 9 [EC:3.4.21.-]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Brite
Enzymes [BR:rss01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     109453901 (TMPRSS9)
Peptidases [BR:rss01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   109453901 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1091 aa AA seqDB search
MEPTIGELQLVPGATKEVPAQDTACCRAALSAAVATSIVIVTLAVLVASLSTQGVAVEHT
AELRGIWYACSLQQEASDYYRALTPALETLFVSSFRNTELEASCMGCTVLSYRDGNSSVF
VRFRLHFLLLALRSLDLGLERELLQQGLRTRLQGHGIPLGAHGTIVSAELAGNQKGPLTE
RDLKSGRCPGNAFSCRDSQCVTKVNPECDDKVDCSDGSDEAHCDCGWQPGWRTAGRIVGG
MEASPGEFPWQVSLRENSEHFCGAAVIGARWLVSAAHCFNEFQDPTEWVAYAGTTHLSGS
EASTVRARVAQIITHPSYNSDTADFDVAVLRLGSPLPFSRHVQPVCLPAASHVFPPRKKC
LISGWGYLKEDFLVKPEMLQKATVELLDQALCASLYGHSLTDRMVCAGYLDGKVDSCQGD
SGGPLVCEESSGRFFLAGIVSWGIGCAEARRPGVYARVTRLRDWILEAIAMTSKPLAPTV
APAPTIPSTAWPTSPESRVVDTTTKLTLDPSSVPLDSVTASKPQECGARPAMEKPTRIVG
GLGAVAGEVPWQVSLKEGSRHFCGATVVGDRWLLSAAHCFNHTKVELVRAHLGTVSLTGI
GGNPVKVGLKRAVLHPQYNPSILDFDVAVLELARPLDFNKYIQPICLPLAIQKFPVGRKC
MISGWGNTQEGNATKPDTLQRASVGIIDQKACSALYNFSLTDRMLCAGFLEGKVDSCQGD
SGGPLACEETPGVFYLAGIVSWGIGCAQAKKPGVYARITTLKGWILDTMSSQPLPTPAPS
TTRTPATSSHAGLTVLGVMASRPTLWATSRATSQPANRTATAMSTTARGHTPLPNTPWTT
MGSQLPDCGLAPVAALTRIVGGSAAGRGEWPWQVSLWLRRREHRCGAVLVAEKWLLSAAH
CFDVYGDPKQWAAFLGTPFLSGADGQLERVAHIYKHPFYNLYTLDYDVALLELAAPVRRN
RLVRPICLPEPAPRPADGARCIITGWGSVREGGSMARQLQKAAVRLLSEQACRRYYPVQI
SSRMLCAGFPHGGVDSCSGDAGGPLACREPSGRWVLTGVTSWGYGCGRPHFPGVYTRVAA
VRGWIGQNIQE
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atggagcccaccattggtgaattacagctcgtgcccggggcaacaaaggaagtccctgct
caggacaccgcgtgctgccgagcagctctgtccgcggcggtggccaccagcatcgtcatc
gtcaccctggcagtccttgtggcctccctctctacacagggtgtcgctgtggagcacacg
gccgagctgcggggcatctggtacgcctgcagcctgcagcaggaggcctccgactactac
cgtgcactgacgcccgccctggaaacgctgtttgtaagcagctttcggaacacagagttg
gaggccagctgcatgggctgcacggtgctaagttacagggatgggaactccagcgtcttt
gtgcgtttccgtctgcacttcctgctgctggccctgcggtcactggacctgggcctggag
cgggagctgctgcagcaggggctccgaacaaggctgcagggccacggcatccccctgggt
gcccacggcaccatcgtgtctgccgagctcgcaggcaaccagaaggggccgttgacagaa
agagacttgaaatcaggtcgctgtccagggaacgccttctcctgcagggacagccagtgc
gtgaccaaagtgaacccggagtgtgatgacaaagtggactgttccgacggatctgacgag
gcccactgtgactgcggttggcagccgggctggaggacagccggcaggattgtggggggc
atggaagcgtcccccggggagttcccttggcaagtcagtctccgagaaaacagcgagcac
ttctgtggggctgcggtgattggggccaggtggctggtttctgctgcccactgcttcaat
gagttccaagaccccaccgagtgggtggcctacgcgggtaccacgcacctcagcggctcg
gaggccagcacggtgcgggcccgcgtggcacaaatcatcactcacccctcttacaactcc
gacacggccgacttcgatgtggcggtcctgcgcctcggcagccccctgcccttcagcagg
cacgtgcagcccgtgtgcctgccggccgcctcacacgttttcccgcccaggaagaagtgt
ctgatctcgggctggggctacctcaaggaggacttcctggtcaagccggagatgctgcag
aaagccaccgtggagctactggaccaggccctgtgcgccagcctgtatggccactctctc
acagaccggatggtgtgtgctggctacctggatgggaaggtggattcctgccagggtgac
tcaggaggtcccctggtctgtgaggagtcctctggcaggttcttcctggccggcattgtg
agctggggcatcggttgtgcagaagcccggcgtccaggagtttatgctcgagtgaccagg
ctgcgagactggatcctggaggcaattgccatgacaagcaagcctctggcccccacggtg
gctcctgccccgaccatccccagcactgcctggcccaccagccccgagagccgggtggtc
gacaccaccaccaaactcacactggaccccagctctgttcctcttgactcagtgactgct
tctaagccacaagagtgtggggccaggccggcaatggagaaacccacccggatcgtgggg
gggttaggagctgttgccggggaggtgccctggcaagtcagcctgaaagaaggttcccgg
cacttctgtggagcgacagtcgtgggggaccgctggctgttgtcggcagcccactgcttc
aaccacacaaaggtggagctggtgcgggcccacctgggcaccgtgtccctcacgggcatt
ggtgggaacccagtgaaagtggggctcaagagggcagtgctgcacccccagtacaacccc
agcatcctggacttcgacgtggctgtcctggagctggccaggcccctggacttcaacaag
tacatccaacccatctgcctgcccctggccatccagaagttccctgtgggccggaagtgc
atgatctctggctggggtaacacgcaggagggaaatgcgacgaagccagacactctgcag
cgagcgtccgtgggcatcatagaccagaaggcgtgcagtgcactctacaacttctcgctc
acagacaggatgctctgtgctggcttcctggagggcaaggtggactcctgccagggtgat
tctggggggcccctggcctgtgaggagacccctggtgtgttttatctggcggggattgtc
agctgggggatcggctgtgcgcaggccaagaaacccggcgtgtacgcacgaatcaccaca
ctgaagggctggatcctggacaccatgtcatcccagcctctccccacacctgccccctcc
acgacgaggacacctgccaccagcagtcatgctggcctcacagtcctgggtgtcatggcc
agcagacccaccctgtgggccaccagcagggccaccagccaacctgccaacaggaccgcc
acagccatgagcaccactgctagggggcacacgccacttccaaacaccccctggaccacc
atggggtcccagctaccagactgcggcctggcgccagtggcagctctgacaaggatcgtg
ggcggcagcgccgcgggccgcggggagtggccgtggcaggtgagcctgtggctgcggcgc
cgggagcaccgctgcggggccgtgctggtcgccgagaagtggctgctgtctgcggcgcac
tgcttcgatgtctacggggaccccaagcagtgggcggcattcctgggaacgccattcctg
agcggcgccgacgggcagctggagcgtgtggcgcacatctacaagcatcccttctataac
ctctacacgctcgactacgacgtggcgctgctcgagctggcggcgcccgtgcgccgcaac
cgcctggtgcgccccatctgcctgcccgagccggcgccccggccagccgacggcgcgcgc
tgcatcatcactggctggggctcggtgcgtgagggaggctccatggcgcggcagctgcaa
aaggcggccgtgcgcctcctcagcgagcaggcctgccgccgctactacccggtgcagatc
agcagccgcatgctgtgcgccggcttcccgcacggcggcgtggacagctgctccggtgac
gctggaggacccctggcttgccgggagccctccggacggtgggtgctaactggggtcacc
agctggggctatggctgtgggcggccccacttcccaggcgtctacaccagggtggctgct
gtgagaggctggatcggacagaacatccaggagtga

DBGET integrated database retrieval system