KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109456030Help
Entry
109456030         CDS       T04863                                 

Gene name
SETDB2
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB2 isoform X1
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:rss00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109456030 (SETDB2)
Enzymes [BR:rss01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109456030 (SETDB2)
Chromosome [BR:rss03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109456030 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    109456030 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 703 aa AA seqDB search
MGEKNGDAKTFWMQLEDDGKVDIMFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVKEAT
ISNNSTLVKDHKPVTQNEQENKSSSLPSTSYEDSFPEDCTILSTKNKDILSLENKAADFR
EKESSLNLSYQSHDCSDACLMKKPQTFKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYK
TPCGRSLRNMEEVFRYLLETECNFLFTDNFSFNTYVQLTRNYPKQEEIVSDVDISNGVES
VPISFCNEIDNRKLPYFKYRKTMWPRAYCLNSFSNMFTDSCDCSEGCIDITKCACLQMTA
RNAKTCPLSSDKIAFGYKHKRLQTHIPTGIYECSLLCKCNRRICQNRVVQHGPQVRLQVF
KTEKKGWGVRCLDDIDKGTFVCIYSGRLLSRSNTEKPDAVDENRKEGNIMKNVFSKKRKI
EVADCEVEVIPLELETNPRRAKTEECPPKFNKNPKEPVIEMKCNTISRIQCHSVIRSPKA
KIAIIQPNGKKMGFASSEYVTSEDDGFKPTQVHLNSKAKEIKMESSSNQVEDSEDNLLIE
SDVIDITKCREETPPEGSYNQATTSDNENAMKEFQVQILTPQEKNSPACQNQQVFCDKQL
PNETKTTSSDSLKISKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHDRNFPLVA
FFSNRYVKARTELTWDYGYEAGTMPEKEILCQCGVNKCRKKIL
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggtgatgcaaagactttctggatgcagctggaagatgatggaaaa
gtggacatcatgtttgagcaagtgcaaaatgtgctacagtcactgaaacaaaagatcaaa
gatgggtctgccacgaataaagaatatatccaagcaatgattctagtgaaggaagcaacc
ataagtaacaattcaacattggtaaaggatcataagcctgtgacccagaatgaacaggaa
aacaaatcaagttcattgccctctacgtcatatgaagactcctttccagaagactgtaca
attctatctacaaaaaataaggacattctttctctggaaaataaagctgcagactttaga
gaaaaagaatcatctctgaatttatcttaccaaagtcatgactgctctgatgcctgtcta
atgaaaaagccacaaaccttcaagggagaaaaccctctacagctaccaatcaaatgccac
ttccaaagacgacatgcgaagactaactctcactcttcagcgctccacgtgagttataaa
accccttgtggaaggagtctacgaaacatggaggaagtttttcgttacctgcttgagaca
gagtgtaactttttatttacagataacttttctttcaatacctatgttcagttgactcgg
aattacccaaagcaagaagaaattgtttctgatgtggatattagcaatggcgtggagtcg
gtgcccatttctttctgtaatgaaattgacaatagaaagcttccatactttaagtacaga
aagactatgtggccacgagcgtattgtctaaacagcttttccaacatgtttactgattca
tgtgactgttctgagggctgcatagacataacaaaatgtgcatgtcttcaaatgacggca
aggaatgctaagacttgccccttgtcaagtgataaaatagcctttggatataaacataaa
agactacagacacacatacctactggcatttatgaatgcagcctgttgtgcaagtgtaat
cgacgaatatgtcaaaaccgagttgtccagcatggacctcaagtgaggctgcaggtgttt
aaaactgagaagaaaggatggggagtgcgctgcctagatgacatcgacaaagggacattt
gtttgcatttattcaggaagattactaagcagatctaacaccgagaaacctgatgctgtt
gatgaaaatagaaaagaaggaaatattatgaaaaatgtgttttcaaaaaagagaaaaata
gaagttgcagattgtgaggttgaagttatcccattagaattggaaacaaatcctagaaga
gctaagactgaagagtgtccacctaagttcaataaaaatccaaaagagcctgttatagaa
atgaaatgtaacactatttcaagaattcagtgtcattcagttattagaagtccgaaagcc
aagatagccattattcaacccaatgggaaaaagatgggatttgcttcctcggaatatgtc
acttctgaagatgatggatttaaaccaacccaagtacatctgaactctaaagccaaggaa
ataaaaatggagtcaagctcaaaccaagttgaagattctgaagacaatctgctgattgaa
tcagatgtgatagatataactaaatgtagagaagaaactccaccagaaggcagctataac
caagcaaccacatcggacaatgagaatgctatgaaggagtttcaggttcaaatactaaca
ccccaagagaaaaactccccagcctgtcaaaaccagcaggtcttttgtgataaacagttg
ccaaatgaaaccaagactacttcatctgattctctgaagatcagtaaaggaaatgtgttt
ttattggatgccacaaaagaagggaatgtgggccgcttccttaatcatagttgttgtcca
aatcttttggtacagaatgtttttgtagaaacacatgacaggaattttccattggtggca
ttcttcagcaacaggtatgtgaaagcaagaacagaactaacatgggattatggttatgaa
gctgggactatgcctgagaaagaaattctctgtcaatgtggggttaataagtgtagaaaa
aaaatattataa

DBGET integrated database retrieval system