KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109459555Help
Entry
109459555         CDS       T04863                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial isoform X1
  KO
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
GABAergic synapse
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rss00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    109459555 (ABAT)
   00650 Butanoate metabolism
    109459555 (ABAT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109459555 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    109459555 (ABAT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109459555 (ABAT)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    109459555 (ABAT)
Enzymes [BR:rss01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     109459555 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     109459555 (ABAT)
Amino acid related enzymes [BR:rss01007]
 Aminotransferase (transaminase)
  Class III
   109459555 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 500 aa AA seqDB search
MASMLLTQRLVCSFQHNYRLFVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSRELMK
QLNIIQNADAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALMKLIQQPQ
NASTFVNRPALGILPPENFVEKLQESLLSVAPKGMSQLITMACGSCSNENAFKTIFMWYR
NKERGQTGFSKEELETCMVNQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLQYPLEEFMKENRQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
DNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLL
DLQARYPQFISRVRGRGTFCSFDTPDESIRNKLILISRNKGVVLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatgttgctcacccagaggctggtctgcagcttccagcacaactatcgcctg
tttgtaccaggatccagacatatcagtcaggctgcagccaaagttgacgttgaatttgat
tatgatgggcctttgatgaagacagaagtcccagggcccagatctcgggagttaatgaaa
cagctgaatataattcaaaacgcagatgctgtgcatttcttctgcaattatgaagagagc
cgaggcaattacctggtcgatgtggatggcaaccggatgctggatctttattctcagatc
tcctctgtccccattggttacagccatcctgctctcatgaaactcatccaacagcctcag
aacgcgagcacgttcgtcaacagacctgccctgggaatcctgcccccagagaactttgtg
gagaaactgcaggagtctttgctctcggtggctcctaaagggatgtcccagctcatcacc
atggcctgcggctcctgctccaatgaaaacgccttcaagaccatcttcatgtggtaccgg
aacaaggaaaggggtcaaacaggtttctccaaagaggagctggagacgtgcatggtcaac
caggcccccggctgccctgactacagcatcctctccttcatgggcgcattccacgggagg
accatgggctgcttagcgaccacacactccaaagctattcacaagatcgatatcccttcc
ttcgactggcccatcgcaccgtttccacggctgcaataccctctggaagagtttatgaag
gagaaccgacaagaagaggcccgctgcctagaagaggtggaggatctgatcgtgaaatac
cggaaaaagaagaagacggtggccgggatcatcgtggaacccatccagtcggagggcgga
gacaaccacgcgtctgatgacttcttccggaagttgagagacatctccaggaagcacggc
tgtgccttcttggtggatgaggtccagacgggagggggctgcaccggcaaattctgggcc
catgagcactggggtttggacgaccctgcagatgtgatgaccttcagcaagaagatgatg
acaggtggcttcttccacaaggaggagttcaggcccaatgctccttaccggatcttcaac
acctggctgggggacccatccaagaacctgctgctggccgaggtcatcaacatcatcaag
cgggaggacctgctgaataatgcagcccacgctgggaaggccctgctcacggggctgctg
gacctccaggcccggtacccccagttcatcagccgagtgagaggacgaggtacattctgc
tcctttgacaccccagatgaatccatacggaacaaactcattttaatatccagaaacaaa
ggcgtggtgttggggggctgtggggacaaatccattcgtttccgtcccactctggtcttc
agggatcaccacgcacacctgttcctcaacattttcagcgacatcttagccgacttcaag
taa

DBGET integrated database retrieval system