KEGG   Rummeliibacillus stabekisii: ATY39_09080Help
Entry
ATY39_09080       CDS       T04369                                 

Definition
(GenBank) ATP-dependent 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rst  Rummeliibacillus stabekisii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:rst00001]
   00010 Glycolysis / Gluconeogenesis
    ATY39_09080
   00030 Pentose phosphate pathway
    ATY39_09080
   00051 Fructose and mannose metabolism
    ATY39_09080
   00052 Galactose metabolism
    ATY39_09080
  Energy metabolism
   00680 Methane metabolism
    ATY39_09080
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ATY39_09080
Enzymes [BR:rst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ATY39_09080
Protein phosphatases and associated proteins [BR:rst01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ATY39_09080
Messenger RNA biogenesis [BR:rst03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ATY39_09080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1839872..1840831)
Genome map
AA seq 319 aa AA seqDB search
MKKIGVLTSGGDAPGMNAAVRAVVRKAIFHGMEVAGIYHGYQGLINGNIENLDVGDVGDI
IQRGGTMLHSARCLEFKTEEGQRKAISQLKEHGIEGLVVIGGDGSYRGALALSKLGFPSV
GVPGTIDNDIPGTDYTIGFDTALNTIIESIDKIRDTATSHERSFIIEVMGRDAGDLALWA
GLAGGAETILIPEVPSDIDGLVRRLEQGYERGKKHSIIIVAEGVMSAGELATLLKEKADI
ETRVSVLGHIQRGGSPTGRDRVLASQLGAKAVEVLMEDRGGVAIGIRNHQVVDYELSEAF
NKAHKAELSMYTLSQELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattggtgtgttaacaagcggtggagatgcgcctggtatgaatgcagctgtt
cgggcagttgtcagaaaagcaatttttcacggcatggaagtcgcgggcatttatcacggc
tatcaaggattaatcaatggtaatattgaaaatctagacgtaggtgatgtaggtgatatc
atccagcggggtggcacgatgctacattctgccagatgtctagaatttaaaacagaagaa
gggcaaagaaaagcaatcagccagcttaaagagcatggcatcgagggcttagtcgttatc
ggcggagatggttcttatcgaggagccttggctttgagcaaattaggtttccctagcgta
ggtgtaccaggaacgattgataatgatattcctggcactgattacaccatcggttttgat
acagctttaaataccattattgaaagcatagacaaaatcagggatacagcaacttcccat
gagcgctcgttcattattgaagtaatgggacgcgatgcaggtgacttagcattatgggct
ggccttgctggcggtgctgaaactatccttattccagaagttccatcagatattgatgga
cttgtcagacgcttagagcaaggatatgaacgtggcaaaaaacatagtattattatcgtc
gcagaaggtgttatgtctgcaggcgagttagctacactattaaaagaaaaagcggatata
gaaacaagagtatcagtattggggcatattcaacgcggtggttcgccgacgggtcgcgat
cgtgtattagctagccaactcggtgcaaaggcagtggaagttttaatggaagaccgaggt
ggagtggcaattggcattcgtaaccatcaggtggtagactatgaattgagtgaagcgttt
aataaagcacataaagcggaattatctatgtataccctttcgcaagaactatcgatctaa

DBGET integrated database retrieval system