KEGG   Ramlibacter tataouinensis: Rta_03240Help
Entry
Rta_03240         CDS       T01544                                 

Gene name
tuf
Definition
(GenBank) Candidate Elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
rta  Ramlibacter tataouinensis
Brite
Translation factors [BR:rta03012]
 Eukaryotic Type
  Elongation factors
   Rta_03240 (tuf)
 Prokaryotic Type
   Rta_03240 (tuf)
Mitochondrial biogenesis [BR:rta03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Rta_03240 (tuf)
Exosome [BR:rta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Rta_03240 (tuf)
  Exosomal proteins of breast cancer cells
   Rta_03240 (tuf)
  Exosomal proteins of colorectal cancer cells
   Rta_03240 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
332450..333640
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSSKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPHIIVFLNKCDMVDDAELLELVEMEVRELLTKYEFPGDDTPIIHGSAKLALE
GDKGDLGEKAIMKLAEAMDTYFPTPQRAVDGAFLMPVEDVFSISGRGTVVTGRVERGVIK
VGEEIEIVGIKATQKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLCKPGS
VKPHTHFTAEIYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGAIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGKTVGSGVVAKIME
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggaaaattcgagcgcaccaagccgcacgtgaacgtgggcacgatcgggcac
gtggaccatggcaagacgacgctgacggcggcgatcacgacggtgctgtcgagcaagttc
ggcggcgaagccaaggcgtacgaccagatcgacgcggcgcccgaggagaaggcgcgcggc
atcaccatcaacaccgcgcacgtggagtacgagacggccaaccgccactacgcgcacgtg
gactgcccgggccacgccgactacgtcaagaacatgatcaccggcgctgcccagatggac
ggcgccatcctggtgtgttccgccgccgacggcccgatgccccagacgcgcgagcacatc
ctcttggcgcgccaggtgggcgtgccgcacatcatcgtgttcctgaataagtgcgacatg
gtggacgacgccgagctcttggagctggtcgagatggaagtgcgcgagctgctgaccaag
tacgaattccccggcgacgacaccccgatcatccacggctcggccaagctggcgctggaa
ggcgacaagggcgacctgggcgagaaggccatcatgaagctggccgaggcgatggacacg
tacttcccgacgccccagcgcgcggtggacggcgcgttcctgatgccggtggaggacgtg
ttctccatctccgggcgcggcacggtggtgaccgggcgcgtcgagcgcggggtgatcaag
gtgggcgaggaaatcgagatcgtgggcatcaaggccacccagaagaccacctgcacgggc
gtggagatgtttcgcaagctgctggaccagggccaggccggcgacaacgtgggcatcctg
ttgcgcggcaccaagcgcgaggacgtcgagcgcggccaggtgctgtgcaagcctggcagc
gtcaagccgcacacgcacttcaccgccgagatctacgtgctctccaaggacgagggcggg
cgccacacgccgttcttcaacaactaccgcccgcagttctacttccgcaccacggacgtg
acgggcgccatcgagctgcccaaggacaaggagatggtgatgcccggggacaacgtgtcc
atcacggtcaagctgatcgcccccatcgccatggaagagggcctgcgctttgccatccgc
gagggcggcaagaccgtcggctcgggcgtcgtcgccaagatcatggaataa

DBGET integrated database retrieval system