KEGG   Rathayibacter tritici: A6122_0691Help
Entry
A6122_0691        CDS       T04388                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rtn  Rathayibacter tritici
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rtn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A6122_0691
  Metabolism of other amino acids
   00480 Glutathione metabolism
    A6122_0691
Enzymes [BR:rtn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     A6122_0691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
752004..753221
Genome map
AA seq 405 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQKIKDTLIHPYLDVNLEYYDLGIEHRDETDDQVTIDA
AHAIQKHGVGVKCATITPDEARVEEFGLKKMWKSPNGTIRNILGGVIFREPIIISNIPRL
VPGWNKPIIIGRHAFGDQYRATDFVFKGKGTLTVEFTPEDGSEPMKFEVYKAPDDGIAQV
QYNQDASIRDFARSSLNYGLSRNYPVYLSTKNTILKAYDGRFKDIFEEIFETEFKERFDA
AGLTYEHRLIDDMVASAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLSTPDGS
VVEAEAAHGTVTRHYRQHQAGKPTSTNPIASIYAWTRGLAHRGTLDGNQELIDFSLTLED
VVITTVESGKMTKDLALLVGPEQGWQTTEEFLATLDENLKVRMSA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagatcaaggttgagggaacagtcgtcgagctcgacggcgacgagatgacacgc
atcatctggcagaagatcaaggacaccctcatccacccgtacctcgatgtgaacctcgag
tactacgacctcggcatcgagcaccgcgacgagacggacgaccaggtcacgatcgacgcg
gcgcacgccatccagaagcacggggtcggcgtgaagtgcgcgaccatcacgcccgatgag
gcccgcgtcgaggagttcggcctgaagaagatgtggaagtcgcccaacggcacgatccgc
aacattctcggcggcgtgatcttccgcgagccgatcatcatctcgaacattccgcgcctg
gttccgggctggaacaagccgatcatcatcgggcgccacgcattcggcgaccagtaccgc
gccaccgacttcgtcttcaagggcaagggcacgctcaccgtcgagttcacgcccgaggac
ggctccgagccgatgaagttcgaggtctacaaggcccccgacgacggcatcgcgcaggtc
cagtacaaccaggacgcctcgatccgcgacttcgctcgctcgtccctgaactacggcctc
tcgcgcaactacccggtctacctctcgaccaagaacacgatcctcaaggcctacgacggg
cgcttcaaggacatcttcgaggagatcttcgagaccgagttcaaggagcgcttcgacgcc
gccggtctcacgtacgagcaccgcctcatcgacgacatggtcgcctcggccatgaagtgg
gagggcggctacgtctgggcctgcaagaactacgacggcgacgtccagtccgacaccgtc
gcccagggcttcggatcgctcggcctgatgacctcggtgctctccactcccgacggaagc
gtcgtcgaggcggaggcggcgcacggcacggtcacgcgccactatcgccagcaccaggcg
ggaaagcccacctcgaccaacccgatcgcctcgatctacgcctggacgcgcggcctcgcg
caccgcggcacgctggacggcaaccaggagctcatcgacttctcgctcacgctcgaggac
gtggtcatcacgacggtcgagtccggaaagatgacgaaggacctcgccctgctcgtcggc
cccgagcagggctggcagacgaccgaggagttcctcgcgaccctcgacgagaacctgaag
gtgcgcatgtcggcctga

DBGET integrated database retrieval system