KEGG   Rhizobium tropici: RTCIAT899_CH16825Help
Entry
RTCIAT899_CH16825 CDS       T02432                                 

Gene name
sucA
Definition
(GenBank) oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rtr  Rhizobium tropici
Pathway
rtr00020  Citrate cycle (TCA cycle)
rtr00310  Lysine degradation
rtr00380  Tryptophan metabolism
rtr01100  Metabolic pathways
rtr01110  Biosynthesis of secondary metabolites
rtr01120  Microbial metabolism in diverse environments
rtr01130  Biosynthesis of antibiotics
rtr01200  Carbon metabolism
Module
rtr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rtr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RTCIAT899_CH16825 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    RTCIAT899_CH16825 (sucA)
   00380 Tryptophan metabolism
    RTCIAT899_CH16825 (sucA)
Enzymes [BR:rtr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     RTCIAT899_CH16825 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N CLASP_N
Motif
Other DBs
NCBI-ProteinID: AGB72728
UniProt: L0LMW8
LinkDB All DBs
Position
complement(3409131..3412115)
Genome map
AA seq 994 aa AA seqDB search
MARQEANEQFQITSFLDGANAAYIEQLYARYEDDPSSVSDEWRSFFKALEDSPDDVRKAA
KGASWQRKNWPIPAKGDLVSALDGDWGVVEKVIETKLKAKAETAGTPASATDVLQATRDS
VRAIMMIRAYRMRGHLHAKLDPLGIAAPVEDYKELSPEAYGFTEADFDRKIFIDNVLGLE
FATVREMIGILERTYCSTLGVEFMHISNPEEKAWIQERIEGPDKGIAFNPERKKAILQKV
IEAEGYEQFLDVKFKGTKRFGLDGGESLIPALEQILKSGSQLGLREAVFGMAHRGRLNVL
SQVMGKPHRAIFHEFKGGSYAPDEVEGSGDVKYHLGASSDRDFDGAKVHVSLTANPSHLE
IVNPVVMGKARAKQDMGATQWDGDIIPLSERAKVVPLLIHGDAAFAGQGVVAEILGLSGL
RGHRVAGTMHVIINNQIGFTTNPAFSRSSPYPSDVAKMIEAPIFHVNGDDPEAVVYAAKI
ATEFRMKFHKPVVLDMFCYRRYGHNEGDEPSFTQPNMYKVIRAHSTVLQIYSQRLVSEGV
LTEGEVEKMKADWRAHLEQEFEAGQSYKPNKADWLDGEWSGLHTADNADEQRRGKTAVPM
KSLKEIGRKLSEIPAGFHAHRTIQRFMENRANMVQTGEGIDWAMAEALAFGSLVVEGHKI
RLSGQDCERGTFSQRHSVLYDQETEERYIPLANLSPTQARYEVINSMLSEEAVLGFEYGY
SLARPNALTLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGYEGQGPEHSS
ARLERYLQLCAEDNMQVANVTTPANYFHILRRQLKRDFRKPLILMTPKSLLRHKRAVSTL
AEMAGESSFHRLLWDDAELIKDGPIKLQKDNKIRRVVICSGKVYYDLLEEREKRGIDDVY
LLRIEQLYPFPAKALINELSRFRNAEMVWCQEEPKNMGAWSFIDPYLEWVLAHIDAKYQR
VRYTGRPAAASPATGLMSKHLSQLAAFLEDALGG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggcaagaagccaacgagcaatttcagatcacctcgttcctggatggcgccaat
gctgcctatatcgagcagctctacgcgcgctacgaggacgatccttcatcggtctccgac
gaatggcggtctttcttcaaggcgctcgaggatagccccgacgatgtgaggaaggcagcg
aagggcgcctcttggcagcgcaagaactggccgatcccggcaaagggcgatctggtttcc
gcgctcgacggcgactggggcgtggtcgaaaaggtcatcgaaaccaagctgaaggcgaag
gcggaaaccgccggtacgccggcgagcgcgaccgacgtgctgcaggcgacgcgcgacagc
gtccgcgccatcatgatgatccgcgcctatcgcatgcgcggccacctgcacgccaagctc
gatccgctcggcatcgccgctccggtcgaagactacaaggagctgtcgccggaagcctat
ggtttcaccgaggccgacttcgaccgcaagatcttcatcgacaacgtactcggcctcgaa
ttcgcgaccgttcgcgagatgatcgggatcctcgagcgcacctactgctccaccctcggc
gtcgaattcatgcatatctccaatccggaggaaaaagcatggattcaagagcgcatcgaa
ggtccggacaagggcatcgctttcaaccccgagcgcaagaaggccatcctccagaaggtc
atcgaagccgaaggctatgagcagttcctcgacgtcaagttcaagggcaccaagcgcttc
ggtctcgacggcggcgaatcgctgatcccggcgctcgaacagatcctcaagagcggcagc
cagctcggtcttcgcgaagccgtcttcggcatggctcaccgcggccgtctgaacgtgctg
tcccaggtcatgggcaaaccgcaccgcgccattttccacgagttcaagggcggctcctac
gcgccggacgaagtcgaaggctcgggcgacgtcaagtaccatctcggcgcttcttcggac
cgcgatttcgatggcgcgaaggtgcacgtctcgctgacggcaaacccgtcgcatctcgaa
atcgtcaatccggtcgtcatgggcaaggcccgcgccaagcaggacatgggcgccacccaa
tgggacggcgacatcatcccgctgtccgagcgcgccaaggtcgtgccgctgctgattcat
ggcgacgcggctttcgctggccagggcgtcgttgccgaaatcctcggtctttccggtctg
cgcggccatcgcgttgccggtacgatgcacgtcatcatcaacaaccagatcggcttcacc
accaatccggccttctcgcgttcgtcgccctatccgtccgacgtcgccaagatgatcgaa
gcgccgatcttccacgtcaacggcgacgatccggaagcggtcgtctacgccgcgaagatc
gcgaccgaattccgcatgaagttccacaagcctgtggtcctcgacatgttctgctatcgc
cgctacggccacaacgaaggcgatgaaccgtccttcacgcagccgaacatgtacaaggtc
atccgcgcccacagcacggtcctgcagatctactcgcagcggctggtcagcgaaggcgtg
ctgaccgaaggcgaagtcgaaaagatgaaggccgattggcgtgcccatctcgagcaggag
ttcgaggccggccagtcctacaagccgaacaaggccgactggctggacggcgagtggtcc
ggtctgcacacggccgacaatgccgacgaacagcgccgtggcaagacggccgtgccgatg
aagtcgctgaaggaaatcggtcgcaagctgtcggaaatcccggccggcttccacgcgcac
cgcaccatccagcgcttcatggaaaatcgcgccaacatggtgcagaccggcgagggcatc
gactgggccatggcggaagccctggcattcggttcgctcgtcgtcgaaggccacaagatc
cgtctgtccggtcaggattgcgaacgcggcaccttctcgcagcgtcattcggttctctac
gatcaggagaccgaagagcgctacattccgctcgccaatctctcgccgacccaggcccgc
tacgaagtcatcaactcgatgctctcggaagaagcggttcttggcttcgaatatggctac
tcgcttgcccgtccgaacgcgctgactctctgggaagctcagttcggcgatttcgccaac
ggcgcgcaggtcgtcttcgaccagttcatctcgtctggcgaacgcaagtggctgcgcatg
tccggcctcgtctgcctgctgccgcatggctatgaaggtcagggtccggagcactcttcg
gctcgcctggaacgctatctgcagctctgcgccgaagacaacatgcaggtcgccaacgtc
acgacgccggcgaactacttccacatcctgcgccgtcagctgaagcgcgacttccgcaag
ccgctgattctgatgacgccgaagtcgctgctgcgccacaagcgtgccgtatcgacgctc
gcggagatggccggcgaaagctcgttccaccgcctgctgtgggacgatgccgaactgatc
aaggacggcccgatcaagctgcagaaggacaacaagatccgtcgcgtcgtcatctgctcg
ggcaaggtctactacgatctcttggaagagcgcgagaagcgcggcatcgacgatgtctac
ctgctgcgcatcgaacagctctatccgttcccggccaaggcgctcatcaacgagcttagt
cgcttccgcaatgcggaaatggtctggtgccaggaagagccgaagaacatgggcgcatgg
tccttcatcgatccctatctggaatgggtgcttgcccatatcgatgccaagtaccagcgc
gttcgctacaccggccgtccggccgccgcctccccggcgacgggcctgatgtccaagcat
ctgtcgcagcttgcggcgttcctcgaggacgcgctcggcggttga

DBGET integrated database retrieval system