KEGG   Ruminiclostridium sp. KB18: A4V00_07175Help
Entry
A4V00_07175       CDS       T04437                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
ruk  Ruminiclostridium sp. KB18
Brite
Translation factors [BR:ruk03012]
 Eukaryotic Type
  Elongation factors
   A4V00_07175
 Prokaryotic Type
   A4V00_07175
Mitochondrial biogenesis [BR:ruk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    A4V00_07175
Exosome [BR:ruk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   A4V00_07175
  Exosomal proteins of breast cancer cells
   A4V00_07175
  Exosomal proteins of colorectal cancer cells
   A4V00_07175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1441362..1442564)
Genome map
AA seq 400 aa AA seqDB search
MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITKVLAMKGDADFMDYANIDKAPEERERG
ITINTAHVEYQTDARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPSIVVFMNKVDQVDDEELLELVEMEVREMLSEYEFPGDDIPFIKGSALQALE
SSSTDPNDPVYASILELMNAVDSYIPTPERKSDLPFLMPVEDVMTITGRGTVATGRVERG
QLKMSEEVELVGLTEETRKVVVTGIEMFRKTLDYAEAGDNVGVLLRGVQRNEIERGQVLS
KPGSIHPHTKFKGQVYVLTKDEGGRHTPFFNNYRPQFYFRTTDVTGVISLPEGTEMCMPG
DNVVMDVELITPIAIEEGLRFAIREGGRTVGSGVVTAINS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggcaaaatttgaacgcaacaaaccccatgtaaacatcggcaccatcggccac
gttgaccatggcaagaccaccctgaccgccgccatcaccaaggtgctggctatgaagggc
gacgccgactttatggattacgccaacatcgacaaggctcccgaggagcgcgagcgcggc
atcaccatcaacaccgcacacgttgagtatcagaccgacgcacgccactatgcccacgtg
gactgccccggccacgccgactacgtcaagaacatgatcaccggcgctgctcagatggac
ggcgctatcctggtggtttccgccgccgacggccccatgccccagacccgcgagcacatc
ctgctggcccgtcaggtgggtgtgcccagcatcgtggtgttcatgaacaaggtcgaccag
gtggacgacgaggagctgctggagctggtggagatggaagtccgcgagatgctcagcgag
tacgagttccccggcgacgatatccccttcatcaagggttccgccctgcaggctctggag
agcagcagcaccgaccccaacgacccggtctatgcttccattctggagctgatgaacgcg
gtcgacagctatatccccacccccgagcgcaagtccgacctgcccttcctgatgcccgtt
gaggacgttatgaccatcaccggccgcggcaccgttgccaccggccgtgtggagcgcgga
cagctgaagatgagcgaggaggtcgagcttgtcggtctgaccgaggagacccgcaaggtg
gtcgtcaccggcatcgagatgttccgcaagaccctggattacgccgaggctggcgacaac
gtgggcgttctgctccgcggtgtgcagcgcaatgagatcgagcgcggccaggttctgtcc
aagcccggctccatccatccccacaccaagttcaagggtcaggtttacgtgctgaccaag
gacgagggcggccgtcatacccccttcttcaacaactaccgtccccagttctacttccgc
accactgacgttaccggcgttatctccctgcccgagggcaccgagatgtgcatgcccggc
gacaacgttgtgatggacgttgagctcatcacccccatcgccatcgaggagggcctgcgc
ttcgctatccgcgagggtggccgtaccgttggctccggcgttgttaccgctatcaattcc
taa

DBGET integrated database retrieval system