KEGG   Rhodomicrobium vannielii: Rvan_0651Help
Entry
Rvan_0651         CDS       T01353                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rva  Rhodomicrobium vannielii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rvan_0651
  Amino acid metabolism
   00310 Lysine degradation
    Rvan_0651
   00380 Tryptophan metabolism
    Rvan_0651
Enzymes [BR:rva01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Rvan_0651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
728976..731945
Genome map
AA seq 989 aa AA seqDB search
MVIEVRRENLNEAFARTSFLHGANAAYIEDLYERFQENPGSVTADWRAFFTDLKERRGTV
DAEALGPSWKPKNGHSDEDGDILNALAADWGPEEGLPINRRIQAKAQQHGVEITREEAFR
ATRESVRAIMLIRAYRVNGHLIGNLDPLHITPPGSHPELDPKTYGFTAADLDHQIYIDNV
LGLETATLRQIIEILKRTYSGTIGFEFMHISSPEQKLWIQERIEGPDKEVEFTALGKKAI
LTKLVHAEGFERFLDKKYTGTKRFGLEGGEAAIPALEQIIKRGGQLGVKEIVIGMPHRGR
LNVLTNVMGKPFRALFHEFKGGSANPEDVEGSGDVKYHLGVSSDREFDGNSVHLSLTANP
SHLEIVDPVVLGKVRAKQDQLGDKTRSEVLPLLMHGDAAFAGQGVVAECFGLSGLKGHRT
GGSIHFIVNNQIGFTTAPRFSRSSPYPSDIARMIEAPIFHVNGDDPEAVVYCARVATEFR
QRFHKPVVIDMICYRRHGHNEGDEPSFTQPLMYKKIRQQQSVVSIYSKRLADENLVKEEE
AEKLKSTFWDKLEQEFIASESYRPNKADWLDGRWSSITLPEEGPRRGNTGVDLDKLRRIG
EKLTELPKGFTAHKTIERFLANRRKTIEEGKGIDWSMAEALALGTLLDEGYPVRLSGQDV
ERGTFSQRHAVLTDQENEEQFTPLNHLSDTQARIEIVNSMLSEEAVLGFEYGYSLAEPNA
LVLWEAQFGDFANGAQVVIDQFLASGERKWLRMSGLVLMLPHGYEGQGPEHSSARLERYL
QLSAEDNWQVANCTTPANYFHILRRQLHRSFRKPLILMTPKSLLRHKRVVSSLDRFGSGT
TFHRVLWDSAQVGKSETVKLVRDEAIKRVVLCTGKVYYDLFEERESRGTNDIYLMRLEQL
YPFPARALIQELSRFPNAEIVWCQEEPKNQGAWTFVESNIEWVLDHIGAETRRPRYVGRP
ACASTAAGLMSKHTAELHAFLDEALTVLG
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcgaagtgagacgggaaaacctcaacgaagcgttcgcgaggacatcgtttctg
cacggtgcgaatgcggcctatatcgaagacctctacgagcgttttcaggagaacccgggg
tctgttactgccgactggcgcgcctttttcaccgatctgaaagaacgccgcgggaccgtc
gacgccgaggctcttggtccgtcgtggaagccgaaaaacggacatagcgacgaggatggc
gacatcctgaacgcgctcgccgccgactgggggccggaagagggccttccgatcaaccgc
cgcattcaggcgaaggcccagcagcacggcgtcgaaatcacccgcgaggaggcgttccgg
gccacgcgcgaaagcgtacgcgcgatcatgctcatccgcgcctaccgcgtgaacggccat
ctcatcggcaatctcgacccgctgcacatcacccctcccggttcgcacccggaacttgat
ccgaagacctacggcttcaccgccgccgacctcgatcaccagatctacatcgataacgtg
ctcggcctcgaaaccgcgaccctgcgccagatcatcgagatcctgaagcgcacctatagc
ggcaccatcggcttcgagttcatgcacatctcctcgccggagcagaagctctggattcag
gagcgcatcgaaggccccgacaaggaagtcgagttcacggcgctcggcaagaaggcgatc
ctcacgaagctcgtccatgccgaggggttcgagcgtttcctcgacaagaaatacacaggc
acgaagcgcttcggccttgaaggcggcgaggcagcgattcccgcgctcgaacagatcatc
aagcgcggcggccagctcggcgtaaaggaaatcgtcatcggcatgccgcatcgcggccgc
ctcaacgtgctcaccaacgtgatgggcaagccgttccgcgcgctgttccacgagttcaag
ggcggctccgccaaccccgaggacgtcgaaggctcgggcgacgtgaagtatcaccttggc
gtgtcgagcgaccgcgagttcgacggcaattccgtgcatctctcgctcaccgcgaacccg
tcgcatctcgaaatcgttgaccccgtcgtgctcggcaaggttcgcgcgaagcaggaccag
ctcggcgacaagacgcgctcggaggttctcccgcttttgatgcacggcgatgccgccttc
gcggggcagggcgtcgtcgcggagtgcttcggcctctccggcctgaaggggcaccgcacc
ggcggctcgatccacttcatcgtcaacaaccagatcggttttaccaccgcgccgcgcttc
tctcgctcatcgccatatccgtcggacatcgcgcgcatgatcgaggcaccgatattccat
gtgaacggcgacgatccggaagccgtggtctactgcgcgcgcgtggcgactgaattccgc
cagcgcttccacaagccggtcgtgatcgacatgatctgctaccggcggcacggccataat
gagggcgatgagccgtccttcacgcagccgctcatgtacaagaagatccgccagcagcag
agcgtggtgtcgatctactcaaagcggctcgcggatgagaacctcgtcaaggaggaagag
gccgagaagctgaaatctaccttctgggacaagctcgaacaggagttcatcgcgtccgaa
agctatcggccgaacaaggccgactggctcgatgggcggtggtcctcgatcacgctgccc
gaggaaggcccgcgtcgcggcaacaccggtgtcgatctcgacaagctgcgccgcatcggc
gaaaagctgaccgagttgccgaaaggcttcacagcgcacaagacgatcgagcgcttcctc
gccaaccgccgcaagacgatcgaggaaggcaagggcatcgattggtccatggcggaggcg
ctcgccctcggtacgctcctcgatgaaggctacccggttcgcctgtcgggtcaggacgtg
gaacgcggcaccttctcgcagcgccacgcggtgctcaccgatcaggaaaacgaggagcag
ttcacgccgctgaatcacctgtccgacacgcaggcgcgcatcgaaatcgtgaattcgatg
ctgtccgaggaggctgttctcggcttcgaatatggctacagcctcgcggagccgaatgcg
ctcgtgctctgggaggcgcagttcggcgacttcgcgaacggcgcgcaggtcgtcatagac
cagttcctcgcgagcggcgaacgcaaatggctgcgcatgtcgggcctcgtgctgatgctg
ccgcacggctatgaagggcaggggccggaacattcctccgcgcgcctcgaacgctacctt
cagctttccgccgaggacaattggcaggtcgcgaactgcaccacgcccgcgaactatttc
cacatcctgcgtcgccagcttcatcgcagcttcaggaagccgctgatcctgatgacgccg
aagtcgctcctcaggcacaagcgcgtggtctcgtcgctcgaccggttcggctcgggaacg
acgttccatcgcgtgctctgggacagcgcgcaggtcggcaagagcgagacggtcaagctc
gtccgcgatgaagccatcaagcgcgtcgtgctctgcaccggcaaggtctattacgacctg
ttcgaggagcgcgagagccgcggcaccaacgatatctacctgatgcgccttgagcagctt
tacccgttcccggcgcgcgcgctgattcaggagctgtcgcgcttcccgaacgccgaaatc
gtctggtgtcaggaagagccgaagaatcagggtgcctggacgttcgtcgagagcaacatc
gagtgggtgctcgatcacataggcgcggaaacgcggcgcccccgttatgtcgggcggcct
gcctgcgcgtcgaccgccgccggtttgatgagcaagcatacggcggagttgcacgcgttc
ctcgacgaagctttgacggtgctgggctag

DBGET integrated database retrieval system