KEGG   Rubrobacter xylanophilus: Rxyl_0220Help
Entry
Rxyl_0220         CDS       T00368                                 

Definition
(GenBank) aminotransferase
Organism
rxy  Rubrobacter xylanophilus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
222452..223762
Genome map
AA seq 436 aa AA seqDB search
MRPGELHERHRAALPAWLSLYYERPIELVRGEGFRVWDSEGNEYLDFFGGIVTTISGHAV
PEIVEAVKEQAERILHSSTLYLIESQVRLAEKLISLSPISGEQKVFFVGSGSEANEAALL
FATQYRGSSEVIALRGSYHGGSFGTMGITGQSSWRPTPRTALDVSYAMPPHRSYSPLYGR
FGDPEELARACAEDVRSLIETSTTGRVAAFIAEPIQGVGGFIELPPAYLSRVKEILEEHG
VLFVSDEVQTAFGRTGSHFWGIERSGVEPDLITMAKGLGNGLAIGAVMGRAEVIDSLSPK
LHISTFGGNPVSTAGALANLEYILENDLQRNAEEVGSYLKERLLGLAAEHASVGEVRGRG
LMLAVELVREGAPDPQAAAAFMEACRERGVLVGKGGLKGNAIRISPPLTVTREAAEEAAR
VFDEALSSVEAGERVV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccggcgagctgcacgagcggcaccgggcggccctcccggcctggctctccctg
tactacgagcgtcccatagagctggtgcgcggcgagggcttccgggtgtgggactccgag
ggcaacgagtacctggacttcttcggcggcatcgtcaccaccataagcggccacgccgtg
ccggagatcgtcgaggcggtaaaggagcaggcggagaggatcctccactcctccaccctc
tacctcatcgagagccaggtgcggctggccgagaagctcatctcgctctcccccatctcc
ggggagcagaaggtcttcttcgtgggcagcggctccgaggccaacgaggcggcgctgctc
ttcgccacccagtacaggggctccagcgaggtgatagccctgcgcggctcctaccacggc
ggctccttcgggacgatggggataaccggacagtcctcctggcgcccgaccccgcgcacc
gccctcgacgtctcctacgcgatgccaccgcaccgctcctacagcccgctctacgggcgc
ttcggcgaccccgaggagctcgcccgggcgtgcgccgaggacgtgaggagcctcatcgag
acctccaccaccgggcgcgtggcggccttcatcgccgagcccatacagggcgtgggcggg
ttcatagagctgccccccgcctacctctcgcgggtgaaggagatactggaggagcacggc
gtcctgttcgtctccgacgaggtgcagaccgccttcgggcgcaccgggagccacttctgg
ggcatcgagcggtccggggtggagcccgacctgatcacgatggccaagggcctgggcaac
gggctcgccatcggggcggtgatgggccgggcggaggtaatagactccctctcgcccaag
ctgcacatctccaccttcggcggcaaccccgtctccaccgccggggcgctggcgaacctg
gagtacatcctcgagaacgacctccagcgcaacgccgaggaggtgggctcctacctcaaa
gagcggctcctcgggctcgccgcggagcacgcctccgtgggggaggtgcgcgggcgcggc
ctgatgctcgccgtcgagctggtgcgcgagggggcgccggacccgcaggccgcggcggcc
tttatggaggcctgccgggagcgcggggtgctggtgggcaagggcggcctgaagggcaac
gccatcaggatctccccgccgctcaccgtgacccgggaggcggccgaggaggccgcccgc
gtcttcgacgaggcgctctccagcgtcgaggccggggagagggtggtctga

DBGET integrated database retrieval system